Lus10032936 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015568 106 / 9e-30 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10032936 pacid=23160363 polypeptide=Lus10032936 locus=Lus10032936.g ID=Lus10032936.BGIv1.0 annot-version=v1.0
ATGTATGCTATTGATGATTCCATTTTCTTGCTCAGAATCCTCAGCAAGAGAAAACGGAAGGCGTTTCGAAAGAAGGAGCAGATGATCTTATTAGCCAAGT
TCCCAAACATAGGCAAGTTAAATGGCTCTAGTGAAGTTTCTGAGAAGCTGCTCAGGAAGAAGGATGTGTGGAAGGTGAGGGACAAGAAAGATAAGCCATG
GCTGGCTGTGGCCAAGAAGAAAAAAAAGGGGATTGGCGCACTGAGATCTGAGAATGATCATCATGGTATTGCTAGTGGAGCAAAGACGAAAACTAAAGTC
TTCAACTCCCATGTCGGTTCCTCGACTGTGTTTTCCGATGGCAGAAGCTCTGCATCGCCGTTTGATGATGTTTCATGGCTCCAGATCCCCAAGAATGTCG
AAGAAAGGCAGCTCATCATCAGTTGTACTCACGAAAGCCTTGTCCAACGGCAAGAAAAGTGGTGA
AA sequence
>Lus10032936 pacid=23160363 polypeptide=Lus10032936 locus=Lus10032936.g ID=Lus10032936.BGIv1.0 annot-version=v1.0
MYAIDDSIFLLRILSKRKRKAFRKKEQMILLAKFPNIGKLNGSSEVSEKLLRKKDVWKVRDKKDKPWLAVAKKKKKGIGALRSENDHHGIASGAKTKTKV
FNSHVGSSTVFSDGRSSASPFDDVSWLQIPKNVEERQLIISCTHESLVQRQEKW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10032936 0 1
AT1G16916 unknown protein Lus10032325 8.5 0.7675
AT1G47710 Serine protease inhibitor (SER... Lus10002792 9.1 0.7625
AT2G44020 Mitochondrial transcription te... Lus10004534 19.6 0.7157
AT1G29850 double-stranded DNA-binding fa... Lus10004540 22.2 0.7509
AT3G19290 bZIP AREB2, ABF4 ABA-RESPONSIVE ELEMENT BINDING... Lus10002399 25.1 0.7340
AT5G66200 ARO2 armadillo repeat only 2 (.1) Lus10036897 28.9 0.7013
AT4G17890 UBP20, AGD8 ARF-GAP domain 8 (.1.2) Lus10004561 34.6 0.7004
AT3G19553 Amino acid permease family pro... Lus10009849 56.7 0.6762
AT1G10150 ATPP2-A10 Carbohydrate-binding protein (... Lus10012487 57.9 0.6782
AT5G27260 unknown protein Lus10037335 60.2 0.6945

Lus10032936 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.