Lus10032937 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015567 183 / 1e-58 AT5G24500 94 / 6e-22 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G021300 48 / 4e-07 AT5G24500 81 / 6e-17 unknown protein
Potri.015G005100 47 / 1e-06 AT5G24500 68 / 2e-12 unknown protein
PFAM info
Representative CDS sequence
>Lus10032937 pacid=23160352 polypeptide=Lus10032937 locus=Lus10032937.g ID=Lus10032937.BGIv1.0 annot-version=v1.0
ATGACGTGCTCAATCTCCGCCGAAAAGTCCAGTTCAAACTGGCTGGACCGCCTCCGCTCCACCAAAGGCTTCCCCACCTCCGGTGACCTCACCCTAGATC
ACTTCCTCACCAATCCCACCGCCGAACAGCCTCCCGATTCCCCTAAACCCGATGTTTCCACCTCCAATTCAAACATCAACTCATCCAACTCCGTCGAGAC
TTCCGCCCAAATTGAAGGAGAAAGGGACTGGTTCGGCGTCATGAACCATGTCCTCTCCGATCTCTTCGTCATGGGCGGCGGCCCCACCACATCCATCTCC
GCGTCAAAGAGCGCCCGTAAACAGACGAACCCTAAGTTTTTCCCGCTTCCTCCTCCGCCGGAAGACGACAACAAGGCTGTTGCCGTCGCCGTCGCTTCTT
CTTTCAATTCCGACCATAACTTGAAATTTAGATAA
AA sequence
>Lus10032937 pacid=23160352 polypeptide=Lus10032937 locus=Lus10032937.g ID=Lus10032937.BGIv1.0 annot-version=v1.0
MTCSISAEKSSSNWLDRLRSTKGFPTSGDLTLDHFLTNPTAEQPPDSPKPDVSTSNSNINSSNSVETSAQIEGERDWFGVMNHVLSDLFVMGGGPTTSIS
ASKSARKQTNPKFFPLPPPPEDDNKAVAVAVASSFNSDHNLKFR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G24500 unknown protein Lus10032937 0 1
AT3G21215 RNA-binding (RRM/RBD/RNP motif... Lus10034844 4.9 0.7726
AT5G62090 SLK2 SEUSS-like 2 (.1.2) Lus10038880 8.2 0.7949
AT1G16560 Per1-like family protein (.1.2... Lus10015006 12.1 0.7829
AT3G26990 ENTH/VHS family protein (.1) Lus10020327 17.9 0.7506
AT4G01000 Ubiquitin-like superfamily pro... Lus10010125 20.8 0.7687
AT5G62090 SLK2 SEUSS-like 2 (.1.2) Lus10015002 24.5 0.7532
AT1G13190 RNA-binding (RRM/RBD/RNP motif... Lus10038759 25.9 0.7516
AT4G15415 ATB'GAMMA, ATB'... Protein phosphatase 2A regulat... Lus10030002 28.7 0.7158
AT5G63260 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Lus10043330 37.1 0.7374
AT3G56850 bZIP DPBF3, AREB3 ABA-responsive element binding... Lus10008928 39.0 0.7323

Lus10032937 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.