Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21100 137 / 5e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 136 / 7e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 135 / 2e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49040 135 / 2e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G55210 132 / 4e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT4G38700 132 / 5e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 130 / 2e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G58170 129 / 9e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G22900 127 / 3e-37 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49030 129 / 2e-34 OVA2 ovule abortion 2, tRNA synthetase class I (I, L, M and V) family protein (.1), tRNA synthetase class I (I, L, M and V) family protein (.2), tRNA synthetase class I (I, L, M and V) family protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029306 [exp] 159 / 2e-49 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017231 [exp] 149 / 8e-46 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034476 [exp] 147 / 9e-45 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10042488 [exp] 142 / 7e-43 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10026176 [exp] 140 / 2e-42 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025067 [exp] 140 / 5e-42 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034482 [exp] 138 / 1e-40 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025063 [exp] 137 / 3e-40 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034479 [exp] 133 / 1e-39 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G214600 [exp] 217 / 9e-73 AT2G21100 164 / 6e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G131000 [exp] 156 / 2e-48 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G061000 [exp] 155 / 4e-48 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216400 [exp] 149 / 1e-45 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216300 [exp] 147 / 1e-44 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.006G195300 [exp] 146 / 2e-44 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G023800 [exp] 142 / 4e-43 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060700 [exp] 140 / 3e-42 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G009100 [exp] 139 / 6e-42 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216200 [exp] 139 / 8e-42 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [flax] [poplar] AOC_barrel PF03018 [flax] [poplar] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Lus10032939 pacid=23160447 polypeptide=Lus10032939 locus=Lus10032939.g ID=Lus10032939.BGIv1.0 annot-version=v1.0 ATGGCGTCAACCCACAGACGTTTCTCCATCAGTCTCCTCCTCACCATCCTCCTCGCCATCTTCGCCGTCTCCACCACCACCACGGAGGCGGCACGGAGAA AGCAGCGGGTCACACGTGTCCAATTCTACATGCACGACGTCGTCAGCGGCCCAAACGCCACAGCCATCCGCATCGCCGGACAAAACTCAACCGGCGCCAT GAACAACAGCAACACCAACCCGGTCGGGGCAATGTTCGGGTCGATCCACATGTTCGACAACCCGCTGACGGTGGGGCCCAGCTGGAACTCCACCGTCCTT GCTCGGGCCCAGGGGTTCTACGGGATGGCTTCGCAGCAGGATGAGTTCGCCCTCCTCATGAGCTTCACCGTCGGATTCGTCACCGGTCCACACAACGGCT CCACGTTCAGCGTCCTCGGGCGGAACCCCATTATGAGCGCCGTCAGGGAGATGCCTGTCGTTGGCGGCACCGGCGCGTTCCGGATGGCGCGTGGGTACTG CCTCGCGTCCACTCGGTCGTTGGACCAGATGGACGCCGTTATTGGCTACAACGTCACACTTTTTCACTATTGA
AA sequence Show only first row Show all	>Lus10032939 pacid=23160447 polypeptide=Lus10032939 locus=Lus10032939.g ID=Lus10032939.BGIv1.0 annot-version=v1.0 MASTHRRFSISLLLTILLAIFAVSTTTTEAARRKQRVTRVQFYMHDVVSGPNATAIRIAGQNSTGAMNNSNTNPVGAMFGSIHMFDNPLTVGPSWNSTVL ARAQGFYGMASQQDEFALLMSFTVGFVTGPHNGSTFSVLGRNPIMSAVREMPVVGGTGAFRMARGYCLASTRSLDQMDAVIGYNVTLFHY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42500			Disease resistance-responsive ...		Lus10032939 [exp]	0	1
AT3G12910	NAC		NAC (No Apical Meristem) domai...		Lus10036194 [exp]	10.9	0.9252
AT4G21120		CAT1, AAT1	CATIONIC AMINO ACID TRANSPORTE...		Lus10023271 [exp]	13.3	0.9218
AT1G20030			Pathogenesis-related thaumatin...		Lus10004410 [exp]	13.6	0.9003
					Lus10023495 [exp]	22.4	0.8976
AT5G10530			Concanavalin A-like lectin pro...		Lus10033781 [exp]	25.3	0.9170
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Lus10001775 [exp]	31.2	0.8541
AT5G06740			Concanavalin A-like lectin pro...		Lus10004166 [exp]	35.1	0.8939
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Lus10026173 [exp]	40.1	0.8915
AT1G23820		SPDS1	spermidine synthase 1 (.1.2)		Lus10039416 [exp]	47.6	0.8937
AT1G65870			Disease resistance-responsive ...		Lus10030483 [exp]	49.3	0.8229

Compare expression of checked genes

Lus10032939 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.