Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53650 85 / 1e-23 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008848 [exp] 116 / 4e-36 AT5G53650 109 / 2e-33 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G022900 [exp] 84 / 3e-23 AT5G53650 82 / 2e-22 unknown protein Potri.015G006500 [exp] 83 / 7e-23 AT5G53650 78 / 7e-21 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032946 pacid=23160446 polypeptide=Lus10032946 locus=Lus10032946.g ID=Lus10032946.BGIv1.0 annot-version=v1.0 ATGGGTTATGTGTTGAGGGTGAGATTGGCGTCGTTCTTCGCCGGAGCGGCAACTGCTTCTTTCGTCGGACTGTACAGCCTCTACAAGGATTACAAAGTTG CTCATGAATCCATCTCTCAACAGGTGAAAGGACTTTACGAGACGCTCGATGCTCGGATTTCTGCTCTGGAGAATTTGAAACAAACTGAAGTTTCTCAAGC GGCAGAGGCAACAGAGTAG
AA sequence Show only first row Show all	>Lus10032946 pacid=23160446 polypeptide=Lus10032946 locus=Lus10032946.g ID=Lus10032946.BGIv1.0 annot-version=v1.0 MGYVLRVRLASFFAGAATASFVGLYSLYKDYKVAHESISQQVKGLYETLDARISALENLKQTEVSQAAEATE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53650			unknown protein		Lus10032946 [exp]	0	1
AT1G77350			unknown protein		Lus10018864 [exp]	1.0	0.8769
AT5G24165			unknown protein		Lus10014921 [exp]	1.4	0.8488
AT3G29130			unknown protein		Lus10038450 [exp]	2.4	0.8197
AT3G03100			NADH:ubiquinone oxidoreductase...		Lus10007886 [exp]	2.8	0.8055
AT4G33740			unknown protein		Lus10012453 [exp]	3.5	0.8363
AT3G62790			NADH-ubiquinone oxidoreductase...		Lus10035034 [exp]	4.5	0.8315
AT1G30475			unknown protein		Lus10027131 [exp]	5.5	0.8024
AT3G01390		AVMA10, VMA10	vacuolar membrane ATPase 10 (....		Lus10016977 [exp]	5.5	0.8297
AT5G40570			Surfeit locus protein 2 (SURF2...		Lus10003658 [exp]	5.9	0.8055
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10041513 [exp]	8.8	0.7955

Compare expression of checked genes

Lus10032946 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.