Lus10032947 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10032947 pacid=23160402 polypeptide=Lus10032947 locus=Lus10032947.g ID=Lus10032947.BGIv1.0 annot-version=v1.0
ATGTACCTAGCGAAGATTGCTGACGCCCAGCCACAACAGCCACAGGGGACACCACAGCAGCAGCAGCCACAGGGGACACCACAGCCGCAGCAGCCACAGG
GGATGGCACAGCAGCCACTACAAGCCCAGCAATGGCGGTCCATACAACAAGAGAAGCAGCAGCAGAATTACATGATGCAACCATCACAAGGTCAAGGTGA
ATGGCAACAGCAGCAGTCAATGTACCTTGCTCAGAAACAACCTTTCCAAATCAACGATCCAATGCTGCAACAGCCCCATCAAGGGTAG
AA sequence
>Lus10032947 pacid=23160402 polypeptide=Lus10032947 locus=Lus10032947.g ID=Lus10032947.BGIv1.0 annot-version=v1.0
MYLAKIADAQPQQPQGTPQQQQPQGTPQPQQPQGMAQQPLQAQQWRSIQQEKQQQNYMMQPSQGQGEWQQQQSMYLAQKQPFQINDPMLQQPHQG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10032947 0 1
AT4G37130 hydroxyproline-rich glycoprote... Lus10022470 3.0 0.9289
AT5G07380 unknown protein Lus10032518 7.7 0.9004
AT3G54560 HTA11 histone H2A 11 (.1) Lus10018753 9.8 0.9186
AT3G20260 Protein of unknown function (D... Lus10033354 10.1 0.9199
AT5G62710 Leucine-rich repeat protein ki... Lus10033104 14.4 0.9105
AT5G10400 Histone superfamily protein (.... Lus10031822 19.6 0.9050
AT5G66840 SAP domain-containing protein ... Lus10008134 20.3 0.8733
AT3G46940 DUT1 DUTP-PYROPHOSPHATASE-LIKE 1 (.... Lus10010809 20.5 0.9057
AT4G10890 unknown protein Lus10001812 21.7 0.9022
AT3G53730 Histone superfamily protein (.... Lus10023331 22.0 0.8987

Lus10032947 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.