Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008842 [exp] 145 / 1e-43 AT1G57680 82 / 4e-17 unknown protein Lus10008924 [exp] 49 / 9e-08 AT1G57680 369 / 3e-126 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G023500 [exp] 73 / 1e-16 AT1G57680 111 / 6e-28 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032951 pacid=23160425 polypeptide=Lus10032951 locus=Lus10032951.g ID=Lus10032951.BGIv1.0 annot-version=v1.0 ATGAGGCTGTTCGGATTGACGCTCGTCGTGATGGTGACGCTACCTTTACAGCTGGTGTCTCTCGGGTTTTCGGTGATGTGGACCCCACGTGACGAGGCAT ACGCCGTGCTGTCCCTCGTGATCTTCCTTACCGCTCTTGTGATCGCGGCCGTTGGGGAAGGGATTTTGGTGATTCAGCCCATTGCCGATTCGCTGGCGGT TGGATCGCAGGAGATCCAATTGGGGGGATCGGGGCAGCATAATGCGGTAGCGGCGGCGGCGGAGGAGGAGGAAATAGCGATGGTGGCGGTCGTTGCGCCA ATCGATGGTAGTAGTGTACAGGTTTGA
AA sequence Show only first row Show all	>Lus10032951 pacid=23160425 polypeptide=Lus10032951 locus=Lus10032951.g ID=Lus10032951.BGIv1.0 annot-version=v1.0 MRLFGLTLVVMVTLPLQLVSLGFSVMWTPRDEAYAVLSLVIFLTALVIAAVGEGILVIQPIADSLAVGSQEIQLGGSGQHNAVAAAAEEEEIAMVAVVAP IDGSSVQV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10032951 [exp]	0	1
AT5G22060		ATJ2	ARABIDOPSIS THALIANA DNAJ HOMO...		Lus10004109 [exp]	2.8	0.8997
AT4G02040			unknown protein		Lus10019069 [exp]	4.2	0.8683
AT1G14340			RNA-binding (RRM/RBD/RNP motif...		Lus10012843 [exp]	7.7	0.8331
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10031982 [exp]	8.5	0.8500
AT5G47120		ATBI-1, ATBI1	ARABIDOPSIS BAX INHIBITOR 1, B...		Lus10011006 [exp]	9.4	0.8423
AT2G43090			Aconitase/3-isopropylmalate de...		Lus10007488 [exp]	11.3	0.8366
AT2G20940			Protein of unknown function (D...		Lus10025069 [exp]	12.2	0.8412
AT1G76920			F-box family protein (.1)		Lus10028591 [exp]	14.8	0.8240
AT3G44110		ATJ3	DNAJ homologue 3 (.1.2)		Lus10013364 [exp]	15.4	0.8386
AT4G24370			unknown protein		Lus10010164 [exp]	17.0	0.7780

Compare expression of checked genes

Lus10032951 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.