Lus10032957 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G13310 107 / 3e-30 Chaperone DnaJ-domain superfamily protein (.1)
AT2G17880 94 / 3e-25 Chaperone DnaJ-domain superfamily protein (.1)
AT4G36040 85 / 1e-21 J11 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
AT4G13830 64 / 9e-14 J20 DNAJ-like 20 (.1.2)
AT1G56300 60 / 6e-12 Chaperone DnaJ-domain superfamily protein (.1)
AT4G39960 61 / 1e-11 Molecular chaperone Hsp40/DnaJ family protein (.1)
AT3G17830 61 / 2e-11 Molecular chaperone Hsp40/DnaJ family protein (.1)
AT2G20560 60 / 2e-11 DNAJ heat shock family protein (.1)
AT2G22360 60 / 3e-11 DNAJ heat shock family protein (.1)
AT1G80030 59 / 4e-11 Molecular chaperone Hsp40/DnaJ family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017263 87 / 2e-22 AT4G36040 106 / 2e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10041906 84 / 2e-21 AT4G36040 144 / 8e-45 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10028453 83 / 9e-21 AT2G17880 146 / 2e-45 Chaperone DnaJ-domain superfamily protein (.1)
Lus10034484 78 / 2e-19 AT4G36040 100 / 3e-28 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10025060 73 / 2e-17 AT4G36040 102 / 7e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10002355 68 / 1e-14 AT4G13830 139 / 2e-41 DNAJ-like 20 (.1.2)
Lus10013558 64 / 2e-14 AT4G36040 82 / 1e-21 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10003150 67 / 3e-14 AT4G13830 151 / 3e-46 DNAJ-like 20 (.1.2)
Lus10003149 62 / 2e-12 AT4G13830 141 / 5e-42 DNAJ-like 20 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G107600 119 / 3e-35 AT3G13310 109 / 4e-31 Chaperone DnaJ-domain superfamily protein (.1)
Potri.001G469600 109 / 3e-31 AT3G13310 120 / 4e-35 Chaperone DnaJ-domain superfamily protein (.1)
Potri.011G166500 100 / 1e-27 AT3G13310 115 / 4e-33 Chaperone DnaJ-domain superfamily protein (.1)
Potri.006G001301 99 / 4e-27 AT3G13310 102 / 2e-28 Chaperone DnaJ-domain superfamily protein (.1)
Potri.002G020700 92 / 3e-24 AT2G17880 108 / 3e-30 Chaperone DnaJ-domain superfamily protein (.1)
Potri.002G020800 90 / 1e-23 AT2G17880 110 / 3e-31 Chaperone DnaJ-domain superfamily protein (.1)
Potri.005G113100 89 / 2e-23 AT2G17880 139 / 6e-43 Chaperone DnaJ-domain superfamily protein (.1)
Potri.005G240700 86 / 5e-22 AT2G17880 105 / 2e-29 Chaperone DnaJ-domain superfamily protein (.1)
Potri.004G172300 85 / 1e-21 AT2G17880 115 / 2e-33 Chaperone DnaJ-domain superfamily protein (.1)
Potri.009G131800 79 / 8e-20 AT2G17880 109 / 9e-32 Chaperone DnaJ-domain superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0392 Chaperone-J PF00226 DnaJ DnaJ domain
Representative CDS sequence
>Lus10032957 pacid=23160404 polypeptide=Lus10032957 locus=Lus10032957.g ID=Lus10032957.BGIv1.0 annot-version=v1.0
ATGATGTCTTCAATTTCATTCTCAACCACCAACAGCGCCGCTCTACTTCCAACCACTACGCCTCGGTTCCGCACCCGACTTAACGCCAGGGCCTCCGTCG
TCGGTGCAGTTCAAGTGGCCCACCAAAATTCAACGTCGCTGAGCCTGTACATGATTCTGAAGGTGGAGCGGACGGCATCGTTGAAGGAGATCAAGACCGC
GTACAGGAAACTCGCTAAAGTTGTTCATCCTGACCGAGCAAATCACGACGGAGGGCGGGACTTCATCCAGGTTCATAATGCTTACCAGACGCTGTCGGAT
CCACAGTCCAGAGCCATGTACGATTTATCCTTGGGGATACGGCTGCGCCCCGCTGGGTGTTGTTCGGCTGGTGGGTTTAATCGGACCCGGAAATGGGAGA
CCGACCAGTGCTGGTAG
AA sequence
>Lus10032957 pacid=23160404 polypeptide=Lus10032957 locus=Lus10032957.g ID=Lus10032957.BGIv1.0 annot-version=v1.0
MMSSISFSTTNSAALLPTTTPRFRTRLNARASVVGAVQVAHQNSTSLSLYMILKVERTASLKEIKTAYRKLAKVVHPDRANHDGGRDFIQVHNAYQTLSD
PQSRAMYDLSLGIRLRPAGCCSAGGFNRTRKWETDQCW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G13310 Chaperone DnaJ-domain superfam... Lus10032957 0 1
AT4G02210 unknown protein Lus10008312 2.2 0.7740
AT3G63470 SCPL40 serine carboxypeptidase-like 4... Lus10019748 4.2 0.7122
Lus10031558 5.7 0.7410
AT2G15220 Plant basic secretory protein ... Lus10013860 7.9 0.6304
AT1G61110 NAC ANAC025 NAC domain containing protein ... Lus10003847 14.1 0.6202
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10030411 17.0 0.6187
Lus10027564 18.7 0.6179
AT4G33860 Glycosyl hydrolase family 10 p... Lus10033787 20.8 0.6811
AT4G35700 C2H2ZnF DAZ3 DUO1-activated zinc finger 3, ... Lus10041659 23.5 0.6585
AT2G31500 CPK24 calcium-dependent protein kina... Lus10025570 23.7 0.6518

Lus10032957 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.