Lus10032962 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G33140 346 / 3e-123 PGY2 PIGGYBACK2, Ribosomal protein L6 family (.1)
AT1G33120 346 / 3e-123 Ribosomal protein L6 family (.1)
AT4G10450 336 / 2e-119 Ribosomal protein L6 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005286 391 / 4e-141 AT1G33140 347 / 1e-123 PIGGYBACK2, Ribosomal protein L6 family (.1)
Lus10015588 387 / 2e-139 AT1G33140 350 / 4e-125 PIGGYBACK2, Ribosomal protein L6 family (.1)
Lus10032918 330 / 4e-116 AT1G33140 301 / 9e-105 PIGGYBACK2, Ribosomal protein L6 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G147700 359 / 2e-128 AT4G10450 331 / 2e-117 Ribosomal protein L6 family (.1)
Potri.001G454101 357 / 6e-128 AT1G33140 331 / 1e-117 PIGGYBACK2, Ribosomal protein L6 family (.1)
Potri.001G453900 357 / 6e-128 AT1G33140 331 / 1e-117 PIGGYBACK2, Ribosomal protein L6 family (.1)
Potri.001G454000 357 / 1e-127 AT1G33140 331 / 2e-117 PIGGYBACK2, Ribosomal protein L6 family (.1)
Potri.011G148700 356 / 2e-127 AT1G33140 330 / 4e-117 PIGGYBACK2, Ribosomal protein L6 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00347 Ribosomal_L6 Ribosomal protein L6
Representative CDS sequence
>Lus10032962 pacid=23160382 polypeptide=Lus10032962 locus=Lus10032962.g ID=Lus10032962.BGIv1.0 annot-version=v1.0
ATGAAGACGATCTTGTCGTCTGAGACGATGGACATTCCAGAGGGCGTGAAAATCAAGGTTCACGCCAAAGTGATCGAGGTCGAAGGTCCACGAGGGAAGC
TGGTGCGTGATTTCAAGCACCTCAATCTCGATTTCCAGCTAATCAAGGATGAGGAGACTGGAAGTCGAAAGCTCAAGATCGACGCTTGGTTCGGATCCAG
GAAGACCAGCGCCTCCATCCGTACCGCCCTCAGCCACGTCCAGAATCTAATCACCGGTGTCACCAAGGGCTACCGATACAAGATGCGGTTCGTCTATGCC
CATTTTCCCATCAACGCCTCCATCACTAGCACTAACAAGGCCATTGAGATCCGTAACTTCCTTGGCGAAAAGAGGGTGAGGAAAGTCGATATGCTTGATG
GTGTGACTGTTATCAGGAGCGAGAAGGTGAAAGATGAGTTGGTTTTGGATGGGAATGATGTTGAGCTCGTATCAAGATCGGCTGCTCTGATTAATCAGAA
ATGCCATGTGAAAAACAAGGATATCAGAAAGTTCTTGGATGGTATCTACGTAAGTGAGAGAGGAACTATTGTGGAGGAAGAGTGA
AA sequence
>Lus10032962 pacid=23160382 polypeptide=Lus10032962 locus=Lus10032962.g ID=Lus10032962.BGIv1.0 annot-version=v1.0
MKTILSSETMDIPEGVKIKVHAKVIEVEGPRGKLVRDFKHLNLDFQLIKDEETGSRKLKIDAWFGSRKTSASIRTALSHVQNLITGVTKGYRYKMRFVYA
HFPINASITSTNKAIEIRNFLGEKRVRKVDMLDGVTVIRSEKVKDELVLDGNDVELVSRSAALINQKCHVKNKDIRKFLDGIYVSERGTIVEEE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10032962 0 1
AT3G49910 Translation protein SH3-like f... Lus10019283 1.0 0.9566
AT5G07900 Mitochondrial transcription te... Lus10041122 2.8 0.9397
AT4G29830 VIP3 vernalization independence 3, ... Lus10021571 3.7 0.9223
AT3G09630 Ribosomal protein L4/L1 family... Lus10019904 4.5 0.9439
AT4G36130 Ribosomal protein L2 family (.... Lus10041923 6.0 0.9422
AT5G60670 Ribosomal protein L11 family p... Lus10041308 7.7 0.9367
AT5G18380 Ribosomal protein S5 domain 2-... Lus10034378 9.5 0.9225
AT5G05520 Outer membrane OMP85 family pr... Lus10017441 9.8 0.9340
AT5G64950 Mitochondrial transcription te... Lus10004329 10.7 0.8943
AT3G57490 Ribosomal protein S5 family pr... Lus10014909 11.0 0.9271

Lus10032962 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.