Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G50380 206 / 3e-64 Prolyl oligopeptidase family protein (.1) AT1G69020 89 / 9e-22 Prolyl oligopeptidase family protein (.1) AT5G66960 66 / 7e-14 Prolyl oligopeptidase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015387 [exp] 234 / 7e-74 AT1G50380 1096 / 0.0 Prolyl oligopeptidase family protein (.1) Lus10032920 [exp] 216 / 1e-67 AT1G50380 1018 / 0.0 Prolyl oligopeptidase family protein (.1) Lus10004631 [exp] 87 / 6e-21 AT1G69020 830 / 0.0 Prolyl oligopeptidase family protein (.1) Lus10026683 [exp] 84 / 4e-20 AT1G69020 785 / 0.0 Prolyl oligopeptidase family protein (.1) Lus10015586 [exp] 81 / 7e-19 AT1G50380 348 / 5e-114 Prolyl oligopeptidase family protein (.1) Lus10017568 [exp] 72 / 8e-16 AT5G66960 1124 / 0.0 Prolyl oligopeptidase family protein (.1) Lus10032378 [exp] 72 / 8e-16 AT1G69020 372 / 1e-116 Prolyl oligopeptidase family protein (.1) Lus10026659 [exp] 65 / 2e-14 AT1G69020 156 / 4e-45 Prolyl oligopeptidase family protein (.1) Lus10033954 [exp] 50 / 6e-08 AT4G11080 283 / 5e-91 3xHigh Mobility Group-box1, HMG (high mobility group) box protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G001300 [exp] 209 / 8e-65 AT1G50380 1149 / 0.0 Prolyl oligopeptidase family protein (.1) Potri.010G137801 [exp] 89 / 7e-22 AT1G69020 889 / 0.0 Prolyl oligopeptidase family protein (.1) Potri.007G035900 [exp] 66 / 2e-13 AT5G66960 1087 / 0.0 Prolyl oligopeptidase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [flax] [poplar] AB_hydrolase PF00326 [flax] [poplar] Peptidase_S9 Prolyl oligopeptidase family
Representative CDS sequence Show only first row Show all	>Lus10032964 pacid=23160400 polypeptide=Lus10032964 locus=Lus10032964.g ID=Lus10032964.BGIv1.0 annot-version=v1.0 ATGAGGCCTGATTTGTTCAAGGCTGCAGTTTCTGGAGTTCCTTTTGTTGATGTTGTGACAACAATGCTTGATCCAATCATACCTCTTACAACTGCAGAGT GGGAGGAATGGCGAGATCCTCGAAAGGAGGAATTCTATCAATACATGAAGTCGTACTCCCCCGTGGACAATGTTGCGGCGCAAGACTATCCCGATATTCT TGTTACAACTGGTTTACACGATCCACGCGTACTGTACTCAGAGCCAGCGAAGTATGTGGCTAAGCTGAGGGATATGAAAACTGATAATAACATGCTGTTG TTTAAATGCGAATTTGGTGCTGGACATATGTCAAAATCTGGAAGGTAA
AA sequence Show only first row Show all	>Lus10032964 pacid=23160400 polypeptide=Lus10032964 locus=Lus10032964.g ID=Lus10032964.BGIv1.0 annot-version=v1.0 MRPDLFKAAVSGVPFVDVVTTMLDPIIPLTTAEWEEWRDPRKEEFYQYMKSYSPVDNVAAQDYPDILVTTGLHDPRVLYSEPAKYVAKLRDMKTDNNMLL FKCEFGAGHMSKSGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G50380			Prolyl oligopeptidase family p...		Lus10032964 [exp]	0	1
AT3G19550			unknown protein		Lus10013901 [exp]	1.0	0.9982
AT1G74220			unknown protein		Lus10040518 [exp]	1.4	0.9940
AT3G19550			unknown protein		Lus10002114 [exp]	3.0	0.9918
AT2G39510			nodulin MtN21 /EamA-like trans...		Lus10040310 [exp]	3.9	0.9861
AT1G78980		SRF5	STRUBBELIG-receptor family 5 (...		Lus10034790 [exp]	4.5	0.9873
AT3G19550			unknown protein		Lus10002115 [exp]	4.9	0.9855
AT2G46200			unknown protein		Lus10021211 [exp]	6.2	0.9450
AT4G32110			Beta-1,3-N-Acetylglucosaminylt...		Lus10042384 [exp]	6.5	0.9853
					Lus10038743 [exp]	6.9	0.9823
AT5G64440		ATFAAH	fatty acid amide hydrolase (.1...		Lus10035974 [exp]	7.9	0.9816

Compare expression of checked genes

Lus10032964 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.