Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33030 175 / 3e-54 SQD1 sulfoquinovosyldiacylglycerol 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013513 [exp] 182 / 1e-56 AT4G33030 729 / 0.0 sulfoquinovosyldiacylglycerol 1 (.1) Lus10024985 [exp] 179 / 8e-56 AT4G33030 726 / 0.0 sulfoquinovosyldiacylglycerol 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G228000 [exp] 169 / 1e-51 AT4G33030 751 / 0.0 sulfoquinovosyldiacylglycerol 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF01370 [flax] [poplar] Epimerase NAD dependent epimerase/dehydratase family
Representative CDS sequence Show only first row Show all	>Lus10032973 pacid=23160351 polypeptide=Lus10032973 locus=Lus10032973.g ID=Lus10032973.BGIv1.0 annot-version=v1.0 ATGAGCTGCTTGGACGTTATTCACAACATAGCTTTCACTTGTAAAGCTTGGGAAATTAGAGCTACTGATCTAAATCAAGGAGTCATTTATGGTGTAAAGA CAGAAGAGACGGAAATGCATGAAGAGTTGCAAAACAGGCTTGACTATGATGCTGTCTTTGGAACTGCACTGAATCGCTTCTACATTCAGGCTTCTGTAGA TCATCCGCTGACGGTCTATGGGAAAGGTGGTCAGACCCGGGGTTACCTGGACATGAGGGATACAGTTCAATGTGTTGAACTAGCGATTGCGACGGCCTGG AGAATTCAGAATGTTTAA
AA sequence Show only first row Show all	>Lus10032973 pacid=23160351 polypeptide=Lus10032973 locus=Lus10032973.g ID=Lus10032973.BGIv1.0 annot-version=v1.0 MSCLDVIHNIAFTCKAWEIRATDLNQGVIYGVKTEETEMHEELQNRLDYDAVFGTALNRFYIQASVDHPLTVYGKGGQTRGYLDMRDTVQCVELAIATAW RIQNV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33030		SQD1	sulfoquinovosyldiacylglycerol ...		Lus10032973 [exp]	0	1
AT1G55570		SKS12	SKU5 similar 12 (.1)		Lus10021864 [exp]	1.4	0.9583
					Lus10027893 [exp]	2.0	0.9373
AT2G04160		AIR3	AUXIN-INDUCED IN ROOT CULTURES...		Lus10027895 [exp]	5.5	0.8717
AT4G36470			S-adenosyl-L-methionine-depend...		Lus10028330 [exp]	8.3	0.9013
AT1G05680		UGT74E2	Uridine diphosphate glycosyltr...		Lus10009408 [exp]	11.1	0.8015
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10000559 [exp]	11.2	0.8940
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10002393 [exp]	12.4	0.8416
AT3G44900		ATCHX4	cation/H+ exchanger 4, cation/...		Lus10032621 [exp]	13.0	0.8976
					Lus10009927 [exp]	13.9	0.9007
AT1G14830		DRP1C, ADL5, AD...	DYNAMIN RELATED PROTEIN 1C, AR...		Lus10043352 [exp]	15.2	0.8925

Compare expression of checked genes

Lus10032973 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.