Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63920 40 / 0.0001 TOP3A, AtTOP3alpha topoisomerase 3alpha (.1) AT3G42860 38 / 0.0006 zinc knuckle (CCHC-type) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003766 [exp] 166 / 4e-54 ND 36 / 0.004 Lus10006779 [exp] 134 / 5e-42 AT5G63920 42 / 2e-05 topoisomerase 3alpha (.1) Lus10039973 [exp] 92 / 2e-25 ND / Lus10039338 [exp] 86 / 7e-23 ND / Lus10005485 [exp] 64 / 3e-14 ND 34 / 0.007 Lus10037411 [exp] 66 / 2e-13 AT2G28450 874 / 0.0 zinc finger (CCCH-type) family protein (.1), zinc finger (CCCH-type) family protein (.2) Lus10011688 [exp] 46 / 8e-07 ND / Lus10015856 [exp] 39 / 7e-05 ND / Lus10030560 [exp] 40 / 0.0001 AT3G42860 258 / 1e-82 zinc knuckle (CCHC-type) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G067100 [exp] 39 / 0.0005 AT5G63920 1389 / 0.0 topoisomerase 3alpha (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF06839 [flax] [poplar] zf-GRF GRF zinc finger
Representative CDS sequence Show only first row Show all	>Lus10032975 pacid=23160396 polypeptide=Lus10032975 locus=Lus10032975.g ID=Lus10032975.BGIv1.0 annot-version=v1.0 ATGTCGATCAGATCGACCTCTATCAGGTGTTCGCACGAACACCACGTGGAGGCCGTACTGAAGACGGCGACTACCGCCAAGAACCGCGGTCAGACATTTT TCCGATGTCCATTCTGTACCTCAAACGACTGCGGGTTCTTCGCATGGGAGTCCGAGTGTTCCCGGGATGACGTTGTTTCTCGCCCAGGCGTTTTAAGGAG GCGTGAAGAACCACCGTCGAGCCTACAAATCGATCTAGTGCTACAAGAGATTAGGGGTTTTAGGAACAAGATTGAAGGGTTTGATAACAGAATGACTCTT GTGCTTGGTAGCATGTGGGTAGTTGTTATGTTGGTAGCCATTAGTTGCACAATTAGATAA
AA sequence Show only first row Show all	>Lus10032975 pacid=23160396 polypeptide=Lus10032975 locus=Lus10032975.g ID=Lus10032975.BGIv1.0 annot-version=v1.0 MSIRSTSIRCSHEHHVEAVLKTATTAKNRGQTFFRCPFCTSNDCGFFAWESECSRDDVVSRPGVLRRREEPPSSLQIDLVLQEIRGFRNKIEGFDNRMTL VLGSMWVVVMLVAISCTIR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10032975 [exp]	0	1
AT1G17860			Kunitz family trypsin and prot...		Lus10007890 [exp]	6.0	0.9484
AT1G79460		ATKS1, ATKS, GA...	GA REQUIRING 2, ARABIDOPSIS TH...		Lus10005399 [exp]	17.3	0.9338
AT3G15980			Coatomer, beta' subunit (.1.2....		Lus10002324 [exp]	21.5	0.9180
AT4G23690			Disease resistance-responsive ...		Lus10024715 [exp]	24.9	0.9290
AT2G19070		SHT	spermidine hydroxycinnamoyl tr...		Lus10005358 [exp]	25.6	0.9261
AT2G29070			Ubiquitin fusion degradation U...		Lus10029298 [exp]	26.4	0.9133
AT1G17860			Kunitz family trypsin and prot...		Lus10022302 [exp]	31.9	0.9261
AT1G17860			Kunitz family trypsin and prot...		Lus10042301 [exp]	34.4	0.9256
AT1G17860			Kunitz family trypsin and prot...		Lus10013770 [exp]	34.4	0.9226
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Lus10041642 [exp]	36.7	0.9089

Compare expression of checked genes

Lus10032975 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.