Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39210 101 / 1e-28 CRR7 chlororespiratory reduction 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015380 [exp] 137 / 8e-43 AT5G39210 130 / 2e-39 chlororespiratory reduction 7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G120300 [exp] 104 / 1e-29 AT5G39210 132 / 6e-40 chlororespiratory reduction 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12095 [flax] [poplar] CRR7 Protein CHLORORESPIRATORY REDUCTION 7
Representative CDS sequence Show only first row Show all	>Lus10032982 pacid=23160348 polypeptide=Lus10032982 locus=Lus10032982.g ID=Lus10032982.BGIv1.0 annot-version=v1.0 ATGGTGATGGTGGTGTACTATGCTAATAATGTCAGGTTTGGGCGACAAGAAGGAGGATACATATGTTACAGATTGAGGAAACCATGGCATCAGTGGGGCT CTTGTACCTTACCACCAGGAAAGGATGAAACATTTGTTAACGAAGAGGAACTGAAAGTGAGACTGAAGAGTTACTTGGAGAATTGGCCCACAAAGACCTT AGCACCGGACCTTGCTAGATTTGAGGAGATGGAGGGTGCTGTTTCTTTCTTGCTGGCTTCTGCTTGCGAGCTCGAAATTGATGGCGATGCTGGTTCTCTT CAATGGTATCAAGTTCGTTTGGATTGA
AA sequence Show only first row Show all	>Lus10032982 pacid=23160348 polypeptide=Lus10032982 locus=Lus10032982.g ID=Lus10032982.BGIv1.0 annot-version=v1.0 MVMVVYYANNVRFGRQEGGYICYRLRKPWHQWGSCTLPPGKDETFVNEEELKVRLKSYLENWPTKTLAPDLARFEEMEGAVSFLLASACELEIDGDAGSL QWYQVRLD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G39210		CRR7	chlororespiratory reduction 7 ...		Lus10032982 [exp]	0	1
					Lus10022880 [exp]	2.0	0.8776
AT5G58170		GDPDL7, SVL5	Glycerophosphodiester phosphod...		Lus10040036 [exp]	2.4	0.8806
AT2G02470	Alfin	AL6	alfin-like 6 (.1.2)		Lus10042404 [exp]	2.8	0.8505
					Lus10012012 [exp]	3.9	0.8622
					Lus10038255 [exp]	4.9	0.8632
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Lus10024889 [exp]	5.3	0.8579
AT4G31540		ATEXO70G1	exocyst subunit exo70 family p...		Lus10018672 [exp]	5.5	0.8585
AT3G02220			unknown protein		Lus10019392 [exp]	5.7	0.8458
AT5G50600		ATHSD1	hydroxysteroid dehydrogenase 1...		Lus10043187 [exp]	5.8	0.8199
					Lus10016269 [exp]	6.3	0.8461

Compare expression of checked genes

Lus10032982 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.