Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02080 218 / 1e-74 Ribosomal protein S19e family protein (.1) AT5G61170 214 / 3e-73 Ribosomal protein S19e family protein (.1) AT5G15520 211 / 4e-72 Ribosomal protein S19e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013188 [exp] 236 / 1e-81 AT3G02080 259 / 2e-90 Ribosomal protein S19e family protein (.1) Lus10030702 [exp] 234 / 4e-81 AT3G02080 215 / 2e-73 Ribosomal protein S19e family protein (.1) Lus10010339 [exp] 234 / 4e-81 AT3G02080 219 / 1e-74 Ribosomal protein S19e family protein (.1) Lus10000095 [exp] 234 / 4e-81 AT3G02080 219 / 1e-74 Ribosomal protein S19e family protein (.1) Lus10021865 [exp] 233 / 5e-81 AT3G02080 216 / 7e-74 Ribosomal protein S19e family protein (.1) Lus10033532 [exp] 225 / 3e-77 AT3G02080 258 / 3e-90 Ribosomal protein S19e family protein (.1) Lus10020836 [exp] 224 / 8e-77 AT3G02080 258 / 5e-90 Ribosomal protein S19e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G056100 [exp] 211 / 4e-72 AT5G61170 269 / 2e-94 Ribosomal protein S19e family protein (.1) Potri.017G092200 [exp] 211 / 4e-72 AT5G61170 270 / 5e-95 Ribosomal protein S19e family protein (.1) Potri.004G118800 [exp] 210 / 1e-71 AT5G61170 269 / 2e-94 Ribosomal protein S19e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [flax] [poplar] HTH PF01090 [flax] [poplar] Ribosomal_S19e Ribosomal protein S19e
Representative CDS sequence Show only first row Show all	>Lus10032992 pacid=23160320 polypeptide=Lus10032992 locus=Lus10032992.g ID=Lus10032992.BGIv1.0 annot-version=v1.0 ATGGGAACACAGATAGAGCTGCCATCATGGACAGACATTGTTAAGACTGGCAAGTTGAAGGAGCTTGCACCGTATGATCCTGACTGGTACTACATTAGAG CTGCCTCAATGGCAAGAAAGGTGTACCTAAGGGGAGGCATTGGAGTAGGTGCTTTCAGAAGAATATATGGTGGAAGCAAAAGGAACGGAAGCCGTCCACC ACATTTCTGCAAAAGCAGTGGTGCTGTTGCTCGTCATATCCTCCAACAACTGGAGAAGGTGAACATTGTCCAAGTTGATACCAACGGTGGAAGGAAAATC ACTTCAAACGGTCAGAGGGATTTGGACCAAGTTGCTGGGAGGATAATTGTGGTTGCACCTTGA
AA sequence Show only first row Show all	>Lus10032992 pacid=23160320 polypeptide=Lus10032992 locus=Lus10032992.g ID=Lus10032992.BGIv1.0 annot-version=v1.0 MGTQIELPSWTDIVKTGKLKELAPYDPDWYYIRAASMARKVYLRGGIGVGAFRRIYGGSKRNGSRPPHFCKSSGAVARHILQQLEKVNIVQVDTNGGRKI TSNGQRDLDQVAGRIIVVAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G02080			Ribosomal protein S19e family ...		Lus10032992 [exp]	0	1
AT1G22780		RPS18A, PFL1, P...	40S RIBOSOMAL PROTEIN S18, POI...		Lus10042603 [exp]	2.0	0.9620
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10011773 [exp]	2.0	0.9587
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10023730 [exp]	4.5	0.9459
AT4G29430		RPS15AE	ribosomal protein S15A E (.1)		Lus10000975 [exp]	7.9	0.9240
AT1G57540			unknown protein		Lus10035345 [exp]	8.0	0.8903
AT4G18100			Ribosomal protein L32e (.1)		Lus10009591 [exp]	8.3	0.9475
AT4G14320			Zinc-binding ribosomal protein...		Lus10000176 [exp]	8.4	0.9396
AT1G29990		PFD6, PDF6	prefoldin 6 (.1)		Lus10038496 [exp]	10.8	0.8641
AT4G21090		ATMFDX2	ARABIDOPSIS MITOCHONDRIAL FER...		Lus10038832 [exp]	13.2	0.8385
AT5G59850			Ribosomal protein S8 family pr...		Lus10005960 [exp]	14.3	0.9160

Compare expression of checked genes

Lus10032992 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.