Lus10033002 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05550 47 / 2e-08 Hypoxia-responsive family protein (.1)
AT5G27760 46 / 5e-08 Hypoxia-responsive family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015191 63 / 1e-14 AT3G05550 87 / 3e-24 Hypoxia-responsive family protein (.1)
Lus10020658 62 / 2e-14 AT3G05550 94 / 6e-27 Hypoxia-responsive family protein (.1)
Lus10029883 64 / 5e-14 AT3G05550 93 / 2e-24 Hypoxia-responsive family protein (.1)
Lus10031490 40 / 5e-06 AT3G05550 54 / 2e-11 Hypoxia-responsive family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G056000 83 / 1e-22 AT3G05550 58 / 1e-12 Hypoxia-responsive family protein (.1)
Potri.013G015400 45 / 9e-08 AT3G05550 102 / 5e-30 Hypoxia-responsive family protein (.1)
Potri.005G024500 44 / 2e-07 AT5G27760 102 / 4e-30 Hypoxia-responsive family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04588 HIG_1_N Hypoxia induced protein conserved region
Representative CDS sequence
>Lus10033002 pacid=23160361 polypeptide=Lus10033002 locus=Lus10033002.g ID=Lus10033002.BGIv1.0 annot-version=v1.0
ATGGAAGGAGTTCAAGCATGGGTTTCCAAACACAAGCTCGGCACCATTGGAGGAATATGGGCAGCAGCAGTTGGAGGCTCATTTGCTCTTAATAATAATC
GTTCTGCAAAGACCAGTCTTAGGCTCATTCACGCCAGGATGCACGCACAGGCTATAACATTGGCAGTGCTATCTGGAGCAGCTATCTACCATCACTTTTA
TGATCATCATCATCACTCTGCTTCTGCTGCTCGTCCTTGA
AA sequence
>Lus10033002 pacid=23160361 polypeptide=Lus10033002 locus=Lus10033002.g ID=Lus10033002.BGIv1.0 annot-version=v1.0
MEGVQAWVSKHKLGTIGGIWAAAVGGSFALNNNRSAKTSLRLIHARMHAQAITLAVLSGAAIYHHFYDHHHHSASAARP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G05550 Hypoxia-responsive family prot... Lus10033002 0 1
AT5G25940 early nodulin-related (.1) Lus10030052 3.5 0.9732
AT5G51105 Protein of unknown function (D... Lus10019552 5.4 0.9330
AT3G54320 AP2_ERF ATWRI1, ASML1, ... WRINKLED 1, WRINKLED, ACTIVATO... Lus10036719 5.7 0.9312
AT5G56970 ATCKX3, CKX3 cytokinin oxidase 3 (.1) Lus10031188 5.7 0.9545
AT3G50390 Transducin/WD40 repeat-like su... Lus10016779 7.5 0.9658
AT3G48660 Protein of unknown function (D... Lus10003120 8.8 0.9642
Lus10002596 10.8 0.9641
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10010936 12.0 0.9483
AT3G10920 MSD1, MEE33, AT... MATERNAL EFFECT EMBRYO ARREST ... Lus10030534 12.2 0.9608
AT3G09950 unknown protein Lus10039065 13.3 0.9169

Lus10033002 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.