Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009719 [exp] 65 / 4e-16 ND / Lus10015034 [exp] 62 / 2e-13 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033006 pacid=23160328 polypeptide=Lus10033006 locus=Lus10033006.g ID=Lus10033006.BGIv1.0 annot-version=v1.0 ATGACCCGGCCTCCCCTGGCTCTTCCACCGTCCGGGCTCCCCTTCCTCCCTATGCTCCCCCGGCGCAGGCCTACCACGCTTCGCGCCTGCGGCGTTTTCC CCATACGGTCTTTGCCAGTAGTGCCATCCTCCCGGCTGGCTGTATGGGCGGGTTGTCACTCGATGTTGTGTTCTGTTAAGCTATAG
AA sequence Show only first row Show all	>Lus10033006 pacid=23160328 polypeptide=Lus10033006 locus=Lus10033006.g ID=Lus10033006.BGIv1.0 annot-version=v1.0 MTRPPLALPPSGLPFLPMLPRRRPTTLRACGVFPIRSLPVVPSSRLAVWAGCHSMLCSVKL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10033006 [exp]	0	1
AT1G05490		CHR31	chromatin remodeling 31 (.1)		Lus10040137 [exp]	7.9	0.8305
AT5G20520		WAV2	WAVY GROWTH 2, alpha/beta-Hydr...		Lus10027619 [exp]	8.7	0.7721
AT2G25270			unknown protein		Lus10001929 [exp]	11.7	0.8557
AT2G25270			unknown protein		Lus10001945 [exp]	13.5	0.8480
AT2G39870			unknown protein		Lus10004675 [exp]	14.1	0.8420
AT2G27990	HD	PNF, BLH8	POUND-FOOLISH, BEL1-like homeo...		Lus10016110 [exp]	19.0	0.8406
AT3G12210			DNA binding (.1.2)		Lus10018653 [exp]	21.8	0.8352
AT1G76940			RNA-binding (RRM/RBD/RNP motif...		Lus10028598 [exp]	27.1	0.8033
AT2G38370			Plant protein of unknown funct...		Lus10025249 [exp]	29.8	0.8354
AT1G11120			unknown protein		Lus10018564 [exp]	35.5	0.8189

Compare expression of checked genes

Lus10033006 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.