Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G29034 58 / 5e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G234200 [exp] 62 / 7e-15 AT3G29034 67 / 7e-17 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033010 pacid=23160407 polypeptide=Lus10033010 locus=Lus10033010.g ID=Lus10033010.BGIv1.0 annot-version=v1.0 ATGAATGAGAAGAGGAGCGCTGCGGTGATCGGAGTGTTGGGAGCGGTGGTGACGTTGACTGCATATTCACAGAGTATGGTTTCCCCAAACAGCTGCATCG GAACTGGCCTCTTCATTCTCTTCTATGGTTTGCTCGTCGGAGAAGGTTATATCCCCAATCCTCTTGATTTCATGTGA
AA sequence Show only first row Show all	>Lus10033010 pacid=23160407 polypeptide=Lus10033010 locus=Lus10033010.g ID=Lus10033010.BGIv1.0 annot-version=v1.0 MNEKRSAAVIGVLGAVVTLTAYSQSMVSPNSCIGTGLFILFYGLLVGEGYIPNPLDFM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G29034			unknown protein		Lus10033010 [exp]	0	1
AT4G23340			2-oxoglutarate (2OG) and Fe(II...		Lus10009663 [exp]	1.0	0.9393
AT5G54510		DFL1, GH3.6	DWARF IN LIGHT 1, Auxin-respon...		Lus10018510 [exp]	1.7	0.9382
AT3G22800			Leucine-rich repeat (LRR) fami...		Lus10006611 [exp]	2.0	0.9362
AT2G38300	GARP		myb-like HTH transcriptional r...		Lus10002207 [exp]	5.1	0.9386
AT2G03240			EXS (ERD1/XPR1/SYG1) family pr...		Lus10026622 [exp]	5.4	0.8888
					Lus10019691 [exp]	7.7	0.8875
					Lus10019690 [exp]	8.0	0.9031
AT4G25560	MYB	LAF1, ATMYB18	LONG AFTER FAR-RED LIGHT 1, my...		Lus10027458 [exp]	8.4	0.9041
AT3G07570			Cytochrome b561/ferric reducta...		Lus10016080 [exp]	8.7	0.9286
AT1G01490			Heavy metal transport/detoxifi...		Lus10014967 [exp]	8.9	0.8986

Compare expression of checked genes

Lus10033010 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.