Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25940 66 / 3e-15 early nodulin-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030052 [exp] 149 / 3e-48 AT5G25940 74 / 3e-18 early nodulin-related (.1) Lus10019434 [exp] 122 / 2e-37 AT5G25940 75 / 8e-19 early nodulin-related (.1) Lus10043290 [exp] 120 / 7e-37 AT5G25940 76 / 3e-19 early nodulin-related (.1) Lus10002236 [exp] 55 / 8e-11 AT5G25940 82 / 3e-21 early nodulin-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G184000 [exp] 124 / 3e-38 AT5G25940 74 / 4e-18 early nodulin-related (.1) Potri.009G143800 [exp] 114 / 2e-34 AT5G25940 65 / 1e-14 early nodulin-related (.1) Potri.019G033700 [exp] 65 / 2e-14 AT5G25940 68 / 1e-15 early nodulin-related (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03386 [flax] [poplar] ENOD93 Early nodulin 93 ENOD93 protein
Representative CDS sequence Show only first row Show all	>Lus10033027 pacid=23176992 polypeptide=Lus10033027 locus=Lus10033027.g ID=Lus10033027.BGIv1.0 annot-version=v1.0 ATGGCGAAGAATGTGGCTCAATCGACTTGCAGCAGCAGCATGGCTTCACTTGACCAAAGGTTGGCAATGGCAAAGCGTTGCTCTCATGAGGGAGTGGTTG CTGGGGCAAAGGCAGCAGTAGTTGCCAGCATAGCTGCTGCCATTCCAACGATAAGTTCCCTTGCAAGTGCACGTATGCTTCCATGGGCAAGAGCTAATCT CAATCACACTGCACAAGCTCTCATTATCTCCACAGTTGCTGGAGCAGCCTATTTTATTGTTGCTGACAAGACTGTCCTAGCTACAGCAAGAAAGAACTCA TTCAAAGATATTTCTAACAACTGA
AA sequence Show only first row Show all	>Lus10033027 pacid=23176992 polypeptide=Lus10033027 locus=Lus10033027.g ID=Lus10033027.BGIv1.0 annot-version=v1.0 MAKNVAQSTCSSSMASLDQRLAMAKRCSHEGVVAGAKAAVVASIAAAIPTISSLASARMLPWARANLNHTAQALIISTVAGAAYFIVADKTVLATARKNS FKDISNN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G25940			early nodulin-related (.1)		Lus10033027 [exp]	0	1
AT5G05320			FAD/NAD(P)-binding oxidoreduct...		Lus10016392 [exp]	4.1	0.8007
AT1G70520		ASG6, CRK2	ALTERED SEED GERMINATION 6, cy...		Lus10020834 [exp]	10.2	0.7028
					Lus10031954 [exp]	25.2	0.6137
AT5G04550			Protein of unknown function (D...		Lus10002840 [exp]	27.9	0.6514
AT1G26380			FAD-binding Berberine family p...		Lus10023374 [exp]	32.0	0.6572
AT3G44350	NAC	ANAC061	NAC domain containing protein ...		Lus10004206 [exp]	42.0	0.7122
					Lus10038105 [exp]	44.7	0.7046
AT3G49601			unknown protein		Lus10034691 [exp]	47.1	0.6970
AT5G27700			Ribosomal protein S21e (.1)		Lus10010971 [exp]	59.5	0.6826
					Lus10005512 [exp]	72.1	0.6115

Compare expression of checked genes

Lus10033027 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.