Lus10033030 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17486 225 / 4e-74 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 212 / 7e-69 PPPDE putative thiol peptidase family protein (.1)
AT1G47740 202 / 2e-64 PPPDE putative thiol peptidase family protein (.1.2)
AT5G25170 189 / 5e-60 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 181 / 2e-56 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 177 / 4e-55 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 185 / 5e-54 unknown protein
AT4G25680 72 / 1e-14 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 70 / 7e-14 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 55 / 9e-09 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013657 436 / 3e-157 AT4G17486 243 / 1e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10043293 337 / 8e-118 AT4G17486 243 / 3e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10019437 329 / 8e-115 AT4G17486 241 / 1e-80 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040170 231 / 3e-76 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004755 216 / 9e-71 AT4G17486 273 / 2e-93 PPPDE putative thiol peptidase family protein (.1.2)
Lus10007844 211 / 9e-69 AT4G17486 277 / 3e-95 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004372 207 / 8e-64 AT5G47310 244 / 1e-77 PPPDE putative thiol peptidase family protein (.1)
Lus10032708 197 / 5e-63 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10003951 196 / 2e-62 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G070600 318 / 1e-110 AT4G17486 235 / 1e-78 PPPDE putative thiol peptidase family protein (.1.2)
Potri.006G154400 313 / 4e-109 AT4G17486 220 / 8e-73 PPPDE putative thiol peptidase family protein (.1.2)
Potri.003G080300 242 / 1e-80 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.001G154400 239 / 8e-80 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.002G134200 202 / 8e-65 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 199 / 1e-63 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.018G021700 198 / 2e-63 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.014G042300 198 / 4e-63 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 196 / 2e-62 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 195 / 7e-62 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10033030 pacid=23177027 polypeptide=Lus10033030 locus=Lus10033030.g ID=Lus10033030.BGIv1.0 annot-version=v1.0
ATGGAGGTTGGAATCGCTTCGATGACTTCGAGCTCCAGGAAGGAGAATTTGAACGATAGCGGTGGAACCCTTGTGGTTCTGAATGTCTACGATCTCACCC
CTGTCAACAATTATGCTTATTGGTTCGGTTTCGGAATCTTCCATTCTGGCATTGAAGGCATGTTTCTCTCTCTTCTTCTTCCTAATTCCTTCCTCCATTT
CCTCTTTTTGATTTGCTCAGATGTGTCGAGGGTTTCGGTTCATGGCAAGGAGTATGGATTTGGAGCTCATGACTTCCCAGTTAGTGGAGTTTTTGAAGTT
GAGCCAAGAAACTGCCCAGGTTTCATTTACAGAAGTTCCATCCCACTGGGCCACATAACAATGCCTCCTACCGAGTTCAGGACGTTTATAGAGAGCATGG
CTTCTGAGTATCATGGAGACACGTACCACCTTATCTCCAAGAACTGCAACCATTTTACCGATGACGTATGCTCCAGGCTGACTGGAAAGAAAATACCAGG
ATTTGTGAATCGGCTTGCACGGCTAGGAGCTCTGTGCAGTTGTTTGCTTCCTGAAAGCCTTCAAGTAACTACAGTGAAACAGCTGCCTGAACACCATGAC
TTGTTGGAAGATGGAAGCGACTCGCAGACATCAGCCACCTTAACCAATGAATCAACGGAAATCGAAGATACAGAACAAGAGAGGCACCTGCTGTCACCAA
GTCGTGGAGCGGGAGAAGTGTCATTTGTGAAAGAAAGAAGTCCAACGGAAGTTCAGCTACTTCATTGA
AA sequence
>Lus10033030 pacid=23177027 polypeptide=Lus10033030 locus=Lus10033030.g ID=Lus10033030.BGIv1.0 annot-version=v1.0
MEVGIASMTSSSRKENLNDSGGTLVVLNVYDLTPVNNYAYWFGFGIFHSGIEGMFLSLLLPNSFLHFLFLICSDVSRVSVHGKEYGFGAHDFPVSGVFEV
EPRNCPGFIYRSSIPLGHITMPPTEFRTFIESMASEYHGDTYHLISKNCNHFTDDVCSRLTGKKIPGFVNRLARLGALCSCLLPESLQVTTVKQLPEHHD
LLEDGSDSQTSATLTNESTEIEDTEQERHLLSPSRGAGEVSFVKERSPTEVQLLH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G17486 PPPDE putative thiol peptidase... Lus10033030 0 1
AT4G17190 FPS2 farnesyl diphosphate synthase ... Lus10022545 1.0 0.9169
AT5G27450 MVK, MK mevalonate kinase (.1.2.3) Lus10031513 3.0 0.8797
AT1G20770 unknown protein Lus10013217 4.0 0.9052
AT5G44200 ATCBP20, CBP20 CAP-binding protein 20 (.1.2) Lus10033636 4.9 0.8933
AT1G26300 BSD domain-containing protein ... Lus10019194 5.3 0.8733
AT5G15220 Ribosomal protein L27 family p... Lus10007170 6.5 0.8964
AT5G17620 unknown protein Lus10013643 8.3 0.8631
AT5G49510 PFD3, PDF3 prefoldin 3 (.1.2) Lus10011145 8.9 0.8791
AT5G44200 ATCBP20, CBP20 CAP-binding protein 20 (.1.2) Lus10017682 10.0 0.8922
AT4G33250 ATTIF3K1, EIF3K eukaryotic translation initiat... Lus10039931 11.2 0.8842

Lus10033030 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.