Lus10033046 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002071 59 / 4e-11 ND /
Lus10015042 57 / 2e-10 ND /
Lus10010604 56 / 6e-10 ND /
Lus10038678 56 / 8e-10 ND /
Lus10021528 56 / 9e-10 ND /
Lus10014487 55 / 9e-10 ND /
Lus10010826 55 / 1e-09 ND /
Lus10039674 54 / 3e-09 ND /
Lus10024215 54 / 3e-09 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10033046 pacid=23177001 polypeptide=Lus10033046 locus=Lus10033046.g ID=Lus10033046.BGIv1.0 annot-version=v1.0
ATGGATCTGCAAACTCCTCTGCAGAACCTCGGCTGGATGAGGGTTTTGGAAGCTCAAGTTGGTCTCGAGTATTCTCACCCTGTCAGGCAGTTTTATGGCA
ATCTCCATTTTGAACCGGGTTTGTCTCCAGCTTGCTTCACAACTTTTGTAGAAGGATACATGCTCTTCACCACTGCCGACATGATGAGTTCATTTCTCGG
AATGCCAAATCAAGGAGCTTCCGTCACAACTGAGACAAATTTTAGAGCGACTTGGTACGGTATTAAAGATCGTTGGGGTGCTGCTAACAGTTACGGAGTT
CTCCGTGCACACAACAAGTGTTTCGTCGTGGTGTCTTCTCTGTTCTGTCAAAGCGCGAAGCTTGTTCTTCTCGGTCTGAAGAAGAAGAAGTCTTGA
AA sequence
>Lus10033046 pacid=23177001 polypeptide=Lus10033046 locus=Lus10033046.g ID=Lus10033046.BGIv1.0 annot-version=v1.0
MDLQTPLQNLGWMRVLEAQVGLEYSHPVRQFYGNLHFEPGLSPACFTTFVEGYMLFTTADMMSSFLGMPNQGASVTTETNFRATWYGIKDRWGAANSYGV
LRAHNKCFVVVSSLFCQSAKLVLLGLKKKKS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10033046 0 1
AT3G26040 HXXXD-type acyl-transferase fa... Lus10021392 3.2 0.8118
AT5G13800 CRN1, PPH Co-regulated with NYE1, pheoph... Lus10005320 3.7 0.7076
AT1G77980 MADS AGL66 AGAMOUS-like 66 (.1) Lus10039704 4.6 0.7776
AT3G26040 HXXXD-type acyl-transferase fa... Lus10025522 8.1 0.6954
Lus10000901 8.5 0.6900
AT1G26820 RNS3 ribonuclease 3 (.1) Lus10003110 8.9 0.7781
Lus10025786 8.9 0.6955
AT2G22180 hydroxyproline-rich glycoprote... Lus10019667 10.7 0.7222
AT4G15440 CYP74B2, HPL1 hydroperoxide lyase 1 (.1) Lus10030032 14.0 0.7562
AT3G07870 F-box and associated interacti... Lus10012356 20.4 0.6561

Lus10033046 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.