Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02210 74 / 2e-16 COBL1 COBRA-like protein 1 precursor (.1) AT3G29810 72 / 1e-15 COBL2 COBRA-like protein 2 precursor (.1) AT5G60920 69 / 1e-14 COB COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) AT5G15630 62 / 4e-12 IRX6, COBL4 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) AT1G09790 54 / 2e-09 COBL6 COBRA-like protein 6 precursor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012598 [exp] 78 / 7e-18 AT3G02210 697 / 0.0 COBRA-like protein 1 precursor (.1) Lus10034379 [exp] 74 / 2e-16 AT3G02210 685 / 0.0 COBRA-like protein 1 precursor (.1) Lus10017861 [exp] 71 / 4e-16 AT5G60920 300 / 4e-101 COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) Lus10021144 [exp] 73 / 6e-16 AT5G60920 749 / 0.0 COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) Lus10007986 [exp] 73 / 6e-16 AT5G60920 755 / 0.0 COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) Lus10034671 [exp] 72 / 2e-15 AT5G60920 732 / 0.0 COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) Lus10017866 [exp] 66 / 2e-13 AT5G15630 625 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) Lus10034666 [exp] 66 / 2e-13 AT5G15630 627 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) Lus10007217 [exp] 61 / 1e-11 AT1G09790 471 / 1e-164 COBRA-like protein 6 precursor (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G060000 [exp] 72 / 1e-15 AT5G60920 759 / 0.0 COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) Potri.004G117100 [exp] 71 / 2e-15 AT3G02210 724 / 0.0 COBRA-like protein 1 precursor (.1) Potri.015G060200 [exp] 64 / 8e-13 AT5G15630 669 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) Potri.015G060100 [exp] 60 / 2e-11 AT5G15630 739 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) Potri.004G117200 [exp] 60 / 2e-11 AT5G15630 679 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) Potri.017G098600 [exp] 58 / 6e-11 AT5G60920 601 / 0.0 COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) Potri.012G062200 [exp] 58 / 1e-10 AT5G15630 586 / 0.0 IRREGULAR XYLEM 6, COBRA-LIKE4, COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) Potri.017G098700 [exp] 57 / 2e-10 AT5G60920 614 / 0.0 COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family (.1) Potri.004G219200 [exp] 47 / 8e-07 AT1G09790 511 / 2e-180 COBRA-like protein 6 precursor (.1) Potri.004G167100 [exp] 44 / 6e-06 AT3G29810 407 / 2e-139 COBRA-like protein 2 precursor (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033047 pacid=23177044 polypeptide=Lus10033047 locus=Lus10033047.g ID=Lus10033047.BGIv1.0 annot-version=v1.0 ATGATACAACAAGCCGGCCCAACTGGCAACGTGCAGTCCGAGTTGATCTTTGAAAAAGAAACCACAACTTTCACGTTTGACAAAGGTTGGGCATTCCCTA GAAGGATCTACTACAATGGCGATAACTGTGTAGTCGCCGCCAATCGAGATAGAGACTCCGCCGTCTCCCTTTTTTCTTCGATTCCTTCGAATAGGCAGCT TGTCAGAATAGCTGAGCAACTAACTCCGAGTCATCGTCGTCGGAAGACGAAGGAACTCATAATTACAGGAGAGGTGGATATCATATTGTTCGGATTGACG ACTCCTTCAGAAACGAACGATACATTGTTCAGCGCCCTTTCTTTTTTAATCGCTTATGGTCATAGGGTTTGA
AA sequence Show only first row Show all	>Lus10033047 pacid=23177044 polypeptide=Lus10033047 locus=Lus10033047.g ID=Lus10033047.BGIv1.0 annot-version=v1.0 MIQQAGPTGNVQSELIFEKETTTFTFDKGWAFPRRIYYNGDNCVVAANRDRDSAVSLFSSIPSNRQLVRIAEQLTPSHRRRKTKELIITGEVDIILFGLT TPSETNDTLFSALSFLIAYGHRV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G02210		COBL1	COBRA-like protein 1 precursor...		Lus10033047 [exp]	0	1
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10013923 [exp]	5.3	0.8926
AT5G57750			RING/U-box superfamily protein...		Lus10016542 [exp]	6.6	0.8138
AT5G39020			Malectin/receptor-like protein...		Lus10008333 [exp]	7.5	0.8662
					Lus10029261 [exp]	9.9	0.8558
AT5G56990			unknown protein		Lus10029528 [exp]	11.5	0.8558
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10014062 [exp]	12.8	0.8558
					Lus10003825 [exp]	14.1	0.8558
					Lus10038051 [exp]	15.2	0.8558
AT5G01660			unknown protein		Lus10040599 [exp]	16.2	0.8558
AT4G27420		ABCG9	ATP-binding cassette G9, ABC-2...		Lus10029635 [exp]	17.2	0.8558

Compare expression of checked genes

Lus10033047 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.