Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15630 75 / 2e-18 unknown protein AT1G52720 73 / 2e-17 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017768 [exp] 213 / 1e-72 AT3G15630 88 / 2e-23 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G174300 [exp] 91 / 2e-24 AT1G52720 116 / 1e-34 unknown protein Potri.003G059900 [exp] 87 / 1e-22 AT1G52720 110 / 2e-32 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033048 pacid=23177039 polypeptide=Lus10033048 locus=Lus10033048.g ID=Lus10033048.BGIv1.0 annot-version=v1.0 ATGGCCTCCAATCTCCTCAGCCTCCGTTCTGCCGTCATTCGCCCCTACGCCGTATCCGATCCCGACCGCAGGAGGAACTCTTCCACCTCCTCCGCCTCCT CTTCTGCCAAATGGTGGTCACCGATCTTCGGATGGTCCTCCGAGCCGGACTACATCGGAAATGATGGAGGGTCCGATCATCAGGACAAGGATCTGAGCAG ATCGGAGGCGGATCTGGAGTCCAAGCAGCCGAGATCTCGATTTTCGCCAGGATGCTTCACTGCCGAGAAGGCTAAGCAGCTGAGGATGATGACGTCCGAC GCGTCGTCCCACCACGACGCCATGTACCACTCCGCTATTGCCTCTCGCCTCGCCTCTGACTTTAAGAACAACTCCTCCGGCGACCGGTAG
AA sequence Show only first row Show all	>Lus10033048 pacid=23177039 polypeptide=Lus10033048 locus=Lus10033048.g ID=Lus10033048.BGIv1.0 annot-version=v1.0 MASNLLSLRSAVIRPYAVSDPDRRRNSSTSSASSSAKWWSPIFGWSSEPDYIGNDGGSDHQDKDLSRSEADLESKQPRSRFSPGCFTAEKAKQLRMMTSD ASSHHDAMYHSAIASRLASDFKNNSSGDR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15630			unknown protein		Lus10033048 [exp]	0	1
					Lus10006886 [exp]	1.0	0.8120
AT3G11590			unknown protein		Lus10017001 [exp]	8.5	0.7829
AT3G50700	C2H2ZnF	ATIDD2	indeterminate(ID)-domain 2 (.1...		Lus10041723 [exp]	8.5	0.7116
AT3G17950			unknown protein		Lus10027309 [exp]	13.4	0.6830
AT1G49230			RING/U-box superfamily protein...		Lus10006787 [exp]	15.7	0.7193
AT5G57480			P-loop containing nucleoside t...		Lus10025479 [exp]	19.1	0.7188
AT2G30933			Carbohydrate-binding X8 domain...		Lus10001516 [exp]	19.7	0.7281
AT2G30933			Carbohydrate-binding X8 domain...		Lus10031443 [exp]	21.9	0.6883
AT5G57480			P-loop containing nucleoside t...		Lus10006968 [exp]	28.9	0.6495
AT5G57480			P-loop containing nucleoside t...		Lus10006967 [exp]	35.8	0.6504

Compare expression of checked genes

Lus10033048 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.