Gene [FLAX] | FIBexDB

Lus10033051 [FLAX]

External link

JGI Phytozome v13

[genome browser]

Symbol

Arabidopsis homologues

Show only best Show top 10

No hit found

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10006395 [exp]	320 / 5e-112	ND	/
Lus10024749 [exp]	236 / 3e-79	ND	/
Lus10003831 [exp]	231 / 2e-75	ND	/
Lus10042590 [exp]	222 / 7e-74	ND	/
Lus10039395 [exp]	185 / 2e-59	ND	/
Lus10032910 [exp]	186 / 5e-59	ND	/
Lus10027052 [exp]	154 / 2e-48	ND	/
Lus10004816 [exp]	161 / 7e-48	AT5G01470	342 / 6e-118	S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2.3)
Lus10025417 [exp]	150 / 2e-45	ND	/

Poplar homologues

Show only best Show top 10

No hit found

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10033051 pacid=23177028 polypeptide=Lus10033051 locus=Lus10033051.g ID=Lus10033051.BGIv1.0 annot-version=v1.0

ATGAATAGGGAAGTGGATGCTAGTGACGGAATTGATTACTCCGACTGGTTCTTATCCAATGATGTGTACGACACTATCGGTGAAGCGGCGCAAGCAGCAA

AACAGATTGTTTTGACGCTTAATTTCCATCTGATCAAAGGGTCAAATAAAAGCAATGACTCTGAAAAGGAGTGTAGGGTGTATCTTTATTGCTCACGTGG

ACCAGTTCGCAAGTCTGAGGGTTCGGATCCGCCGAAACGTGCTACGAAGTCAAAGAAGTGTAATTGCCCATTCAGACTTGTCGCCCGATCAAAGGTGGTA

GATTGCAAGTGGAAGTATTTTATTGACGGAATCGGAGACATAAAGAACCCTGATAAGTCGAATGACGGAGTCAGAGACATAAAGAACCCTGATCGATCGA

AGGGGTACCACAATCATCATCTGATTCATTTCACTGAAGTAATCACGAAAAGCAATCCGTTATCAGAGGAGGCAAAAAAAGATATTCAGGATATGATGGC

TGTTCACACACAACCGAATAAGATCAGGTATTCTTTGAATAAGAAGTTCAACACTCGTCACAATATGAATCAAATTTACCTTTTTATCGGATGTACCCAA

AGGGATTGCTTTACCCTTTTATTCATAACTAGGTTTTTTTATAATGTGCTGTCATTTATTGATTAA

AA sequence

Show only first row Show all

>Lus10033051 pacid=23177028 polypeptide=Lus10033051 locus=Lus10033051.g ID=Lus10033051.BGIv1.0 annot-version=v1.0

MNREVDASDGIDYSDWFLSNDVYDTIGEAAQAAKQIVLTLNFHLIKGSNKSNDSEKECRVYLYCSRGPVRKSEGSDPPKRATKSKKCNCPFRLVARSKVV

DCKWKYFIDGIGDIKNPDKSNDGVRDIKNPDRSKGYHNHHLIHFTEVITKSNPLSEEAKKDIQDMMAVHTQPNKIRYSLNKKFNTRHNMNQIYLFIGCTQ

RDCFTLLFITRFFYNVLSFID

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10033051 [exp]	0	1

Lus10033051 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.