Lus10033054 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18660 54 / 8e-10 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019444 168 / 1e-54 AT2G18660 68 / 3e-15 plant natriuretic peptide A (.1)
Lus10013118 145 / 2e-45 AT4G30380 67 / 5e-15 Barwin-related endoglucanase (.1)
Lus10017763 111 / 7e-33 ND 35 / 0.001
Lus10030078 96 / 5e-26 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1)
Lus10042435 62 / 8e-13 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10026232 49 / 2e-07 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10020131 46 / 1e-06 AT2G18660 59 / 2e-11 plant natriuretic peptide A (.1)
Lus10020130 45 / 2e-06 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1)
Lus10026930 44 / 9e-06 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G155000 141 / 9e-44 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
Potri.018G031901 140 / 2e-43 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.006G249500 134 / 5e-41 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.018G029100 101 / 3e-28 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G252200 99 / 2e-27 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.003G218300 67 / 6e-15 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.018G098200 59 / 6e-12 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.006G179300 49 / 7e-08 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.018G101600 47 / 2e-07 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.006G176300 44 / 4e-06 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10033054 pacid=23176965 polypeptide=Lus10033054 locus=Lus10033054.g ID=Lus10033054.BGIv1.0 annot-version=v1.0
ATGTCATCAAGCCTAGATTTTTCCTTCCTCCTCCTTATTATAACGATTCTGCAACTCTCCTACTGCTGCATCGCCGATATTGGCACCGCGTCCTGGTACG
CTCCTCCTTATCTACCCACGGCGTGTAACGGCGGCGACAGGTCGCAATTCCCGACCAGCAATCTGTTTGCGGCGGCAGGGGAAGGGATATGGGACAATGG
GGCGGCCTGCGGGAGACAGTACAAAGTTAGGTGTATTAGCTCTGTCGCACGAGGTTCCTGTAAGCCTGATCAGACTATTCAGGTGAAGATCGTCGATCGA
GCTCGGACATTGGTCTCTCCGCCGTCAGCCAGAGGAACCACTATTGTTCTCCCTCTTTTGTTTCTCCCCCAGCGTGTTGGGGGGTCAGCCGCGAGCCCCC
CAGCCAGTACCGGCGTCAACATTGAGTGGCAACAGTAA
AA sequence
>Lus10033054 pacid=23176965 polypeptide=Lus10033054 locus=Lus10033054.g ID=Lus10033054.BGIv1.0 annot-version=v1.0
MSSSLDFSFLLLIITILQLSYCCIADIGTASWYAPPYLPTACNGGDRSQFPTSNLFAAAGEGIWDNGAACGRQYKVRCISSVARGSCKPDQTIQVKIVDR
ARTLVSPPSARGTTIVLPLLFLPQRVGGSAASPPASTGVNIEWQQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10033054 0 1
Lus10026092 4.7 0.8326
AT5G07050 nodulin MtN21 /EamA-like trans... Lus10026112 6.5 0.8198
AT1G61680 ATTPS14 terpene synthase 14 (.1.2) Lus10018392 7.3 0.8186
AT5G56610 Phosphotyrosine protein phosph... Lus10034998 14.1 0.7739
AT4G32630 ArfGap/RecO-like zinc finger d... Lus10022113 14.8 0.7856
AT3G51895 AST12, ATST1, S... sulfate transporter 3;1 (.1) Lus10039364 17.7 0.7983
AT3G56970 bHLH ORG2, bHLH038 OBP3-RESPONSIVE GENE 3, basic ... Lus10010453 18.3 0.7716
AT5G07050 nodulin MtN21 /EamA-like trans... Lus10008708 19.2 0.7228
Lus10003285 22.4 0.7497
Lus10004996 23.5 0.7497

Lus10033054 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.