Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08900 117 / 3e-33 RGP3 reversibly glycosylated polypeptide 3 (.1) AT5G15650 114 / 3e-32 REVERSIBLYGLYCOSYLATEDPOLYPEPTIDE2, RGP2, ATRGP2 reversibly glycosylated polypeptide 2 (.1) AT3G02230 113 / 4e-32 ATRGP1, RGP1 ARABIDOPSIS THALIANA REVERSIBLY GLYCOSYLATED POLYPEPTIDE 1, reversibly glycosylated polypeptide 1 (.1) AT5G50750 107 / 2e-29 RGP4 reversibly glycosylated polypeptide 4 (.1) AT5G16510 90 / 5e-23 RGP5 reversibly glycosylated protein 5, reversibly glycosylated polypeptide 5, Alpha-1,4-glucan-protein synthase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004640 [exp] 124 / 4e-36 AT3G08900 654 / 0.0 reversibly glycosylated polypeptide 3 (.1) Lus10026676 [exp] 124 / 5e-36 AT3G08900 654 / 0.0 reversibly glycosylated polypeptide 3 (.1) Lus10036970 [exp] 120 / 2e-34 AT3G08900 645 / 0.0 reversibly glycosylated polypeptide 3 (.1) Lus10000646 [exp] 120 / 2e-34 AT3G08900 662 / 0.0 reversibly glycosylated polypeptide 3 (.1) Lus10022443 [exp] 119 / 3e-34 AT3G02230 642 / 0.0 ARABIDOPSIS THALIANA REVERSIBLY GLYCOSYLATED POLYPEPTIDE 1, reversibly glycosylated polypeptide 1 (.1) Lus10034665 [exp] 116 / 3e-34 AT5G15650 416 / 7e-148 reversibly glycosylated polypeptide 2 (.1) Lus10016749 [exp] 119 / 4e-34 AT3G02230 570 / 0.0 ARABIDOPSIS THALIANA REVERSIBLY GLYCOSYLATED POLYPEPTIDE 1, reversibly glycosylated polypeptide 1 (.1) Lus10017868 [exp] 117 / 2e-33 AT5G15650 648 / 0.0 reversibly glycosylated polypeptide 2 (.1) Lus10034376 [exp] 115 / 8e-33 AT3G02230 608 / 0.0 ARABIDOPSIS THALIANA REVERSIBLY GLYCOSYLATED POLYPEPTIDE 1, reversibly glycosylated polypeptide 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G101100 [exp] 122 / 4e-35 AT3G02230 610 / 0.0 ARABIDOPSIS THALIANA REVERSIBLY GLYCOSYLATED POLYPEPTIDE 1, reversibly glycosylated polypeptide 1 (.1) Potri.010G156700 [exp] 118 / 6e-34 AT3G08900 658 / 0.0 reversibly glycosylated polypeptide 3 (.1) Potri.008G097600 [exp] 118 / 7e-34 AT3G08900 669 / 0.0 reversibly glycosylated polypeptide 3 (.1) Potri.017G099100 [exp] 118 / 9e-34 AT5G15650 671 / 0.0 reversibly glycosylated polypeptide 2 (.1) Potri.004G117800 [exp] 118 / 1e-33 AT5G15650 663 / 0.0 reversibly glycosylated polypeptide 2 (.1) Potri.015G060300 [exp] 116 / 6e-33 AT3G08900 650 / 0.0 reversibly glycosylated polypeptide 3 (.1) Potri.019G051700 [exp] 96 / 2e-25 AT5G16510 493 / 1e-176 reversibly glycosylated protein 5, reversibly glycosylated polypeptide 5, Alpha-1,4-glucan-protein synthase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0110 [flax] [poplar] GT-A PF03214 [flax] [poplar] RGP Reversibly glycosylated polypeptide
Representative CDS sequence Show only first row Show all	>Lus10033057 pacid=23176999 polypeptide=Lus10033057 locus=Lus10033057.g ID=Lus10033057.BGIv1.0 annot-version=v1.0 ATGCCACACTTCTTCAACACTTTGTACGATCTGTACAGAGAAGGTGTTGAATTTGTTCATGGGTATCCATTCAGTCTCTGTGGGGAAGCCCCAACTATGG CCTCTCATGACATGTGGCTTAACATCCTGGATTACGATGCTCCTACTCAGCTTGTGAAACCCCTCGAGAGGAACTGCAAGTATGTTGATGTTGTGCTGAC TATCCCCAAGGGAACCCTATTCCCTATTTGA
AA sequence Show only first row Show all	>Lus10033057 pacid=23176999 polypeptide=Lus10033057 locus=Lus10033057.g ID=Lus10033057.BGIv1.0 annot-version=v1.0 MPHFFNTLYDLYREGVEFVHGYPFSLCGEAPTMASHDMWLNILDYDAPTQLVKPLERNCKYVDVVLTIPKGTLFPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G08900		RGP3	reversibly glycosylated polype...		Lus10033057 [exp]	0	1

Compare expression of checked genes

Lus10033057 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.