Lus10033076 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44290 102 / 4e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G44300 99 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G55260 97 / 5e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT3G58550 86 / 5e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G27950 70 / 6e-15 LTPG1 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
AT1G73890 67 / 1e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT3G22600 65 / 3e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G48130 62 / 5e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G03103 62 / 6e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G14815 55 / 1e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017749 243 / 4e-82 AT2G44290 115 / 3e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10035975 105 / 2e-26 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1)
Lus10042449 98 / 4e-25 AT1G55260 160 / 3e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10026220 81 / 7e-18 AT2G44300 131 / 6e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10006413 75 / 9e-17 AT1G27950 137 / 5e-41 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
Lus10037027 72 / 7e-16 AT1G27950 147 / 3e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
Lus10015779 71 / 4e-15 AT1G27950 144 / 8e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
Lus10042984 67 / 1e-13 AT1G73890 81 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032488 65 / 5e-13 AT1G73890 84 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G232000 107 / 4e-29 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G195700 97 / 2e-25 AT2G44290 145 / 6e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G008500 95 / 2e-24 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.003G217000 92 / 5e-23 AT1G55260 149 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.003G172400 80 / 2e-18 AT1G27950 145 / 5e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
Potri.001G056200 73 / 6e-16 AT1G27950 149 / 1e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
Potri.015G054000 62 / 6e-12 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.015G053700 62 / 6e-12 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.010G085400 57 / 2e-10 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.008G155100 56 / 7e-10 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF00234 Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence
>Lus10033076 pacid=23177009 polypeptide=Lus10033076 locus=Lus10033076.g ID=Lus10033076.BGIv1.0 annot-version=v1.0
ATGGCAAAAGACAGCAAAAAAGAGTTAGTTTGCGTCCTCATCGTGGCCTTCTTGGCAATAGCTGCAACAGCAACGTTGCAGGAAGACGAGGCAGAATGCG
CAGAGCACCTTGCAGATCTTGCGGCTTGCATTCCATTTGTGAGTGGCACTGCCAAGAAGCCAACAACTGAGTGCTGTCAGGACACCAAGAAACTGAAAGC
CACCGAGCCTAAGTGCTTGTGTGTCCTCATCATCGCGAGCACAGACCCTTCCATGGGTCTCCCCGTCAACACCACCCTTGCCCTTCAATTGCCTTCTGCC
TGCAACATGGATGATGCCAAAGCCTCCAACTGTCCCTCTCTCTTGAACATATCTCCAGACTCCTCAGATGCAAAGGTCTTCAAAGAAGCAGGAATTTCAG
ATTCTTCCACCAGTGGTTCAAGCACAACAACAGGTTCCCCACCAAATTCTGCTTCTACTTCATCAGGCTCATCTTCTTCTTCGTCTTCCCCAGCATCCGC
CTCTTCCACTCCAACTGATTCAAAAGCTTCTCCAAACAGCAGTAATGGCCAAAAGATGAAGGATTTTGGAGCATGGATGTTGATGGCTCTTGCAGCTGGG
ATGCTCTTCTGA
AA sequence
>Lus10033076 pacid=23177009 polypeptide=Lus10033076 locus=Lus10033076.g ID=Lus10033076.BGIv1.0 annot-version=v1.0
MAKDSKKELVCVLIVAFLAIAATATLQEDEAECAEHLADLAACIPFVSGTAKKPTTECCQDTKKLKATEPKCLCVLIIASTDPSMGLPVNTTLALQLPSA
CNMDDAKASNCPSLLNISPDSSDAKVFKEAGISDSSTSGSSTTTGSPPNSASTSSGSSSSSSSPASASSTPTDSKASPNSSNGQKMKDFGAWMLMALAAG
MLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44290 Bifunctional inhibitor/lipid-t... Lus10033076 0 1
AT1G77410 BGAL16 beta-galactosidase 16 (.1) Lus10018138 1.7 0.9484
AT2G45910 U-box domain-containing protei... Lus10017798 2.4 0.9422
AT1G55200 Protein kinase protein with ad... Lus10041608 3.2 0.9242
AT3G28630 Protein of unknown function (D... Lus10015346 3.3 0.9146
AT5G62670 AHA11 H\(+\)-ATPase 11, H\(+\)-ATPas... Lus10028203 4.0 0.9450
Lus10023010 4.9 0.9218
AT5G05570 transducin family protein / WD... Lus10001254 5.5 0.9230
Lus10007802 6.0 0.9284
AT3G28580 P-loop containing nucleoside t... Lus10014497 6.2 0.9031
AT5G48030 GFA2 gametophytic factor 2 (.1) Lus10011934 7.3 0.8699

Lus10033076 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.