Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013271 [exp] 45 / 3e-06 AT3G01280 400 / 3e-142 ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 1, voltage dependent anion channel 1 (.1) Lus10030794 [exp] 45 / 4e-06 AT3G01280 379 / 3e-133 ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 1, voltage dependent anion channel 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G070300 [exp] 97 / 6e-26 AT3G01280 163 / 3e-49 ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 1, voltage dependent anion channel 1 (.1) Potri.010G033500 [exp] 54 / 2e-09 AT3G01280 390 / 5e-138 ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 1, voltage dependent anion channel 1 (.1) Potri.008G194900 [exp] 51 / 1e-08 AT3G01280 418 / 5e-149 ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 1, voltage dependent anion channel 1 (.1) Potri.017G078200 [exp] 42 / 3e-05 AT3G01280 414 / 9e-148 ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 1, voltage dependent anion channel 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033098 pacid=23177013 polypeptide=Lus10033098 locus=Lus10033098.g ID=Lus10033098.BGIv1.0 annot-version=v1.0 ATGAGATATCGCAGTACTCCTCCAACTCCAGGTTTCTACTCTAACATTGGCAAGAATGCAACAGGAGTTGGAGTGAAGGCATATCAGAAAGGACCATTTT CTAAAAATGCCTACAATCCGTTCCTCAGTTTCTCTGCAATCGTAGGAGCCAACAGTCTCTTCTACACTGGAGTAGACATGGTCATCGATGCATCAACGAA GACGTTGGATAACTTCAGTGCTGGTCTCAGCTTCAAGTTCAATGGATCACCCCCCATCACATCGTTTAACTTTGATGACAAGCTGGACACTTTAAGAGCT TCTTTTTACTACTCCTTCAGCCCCCTAACCAGGACAACCAGAGCTCAAGCATAG
AA sequence Show only first row Show all	>Lus10033098 pacid=23177013 polypeptide=Lus10033098 locus=Lus10033098.g ID=Lus10033098.BGIv1.0 annot-version=v1.0 MRYRSTPPTPGFYSNIGKNATGVGVKAYQKGPFSKNAYNPFLSFSAIVGANSLFYTGVDMVIDASTKTLDNFSAGLSFKFNGSPPITSFNFDDKLDTLRA SFYYSFSPLTRTTRAQA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G01280		VDAC1, ATVDAC1	ARABIDOPSIS THALIANA VOLTAGE D...		Lus10033098 [exp]	0	1
AT1G48020		ATPMEI1	ARABIDOPSIS THALIANA PECTIN ME...		Lus10041650 [exp]	1.7	0.7464
AT3G12690		AGC1.5	AGC kinase 1.5 (.1.2.3)		Lus10001757 [exp]	20.0	0.7264
AT3G47090			Leucine-rich repeat protein ki...		Lus10003071 [exp]	22.0	0.7314
AT2G42430	AS2	ASL18, LBD16	ASYMMETRIC LEAVES2-LIKE 18, la...		Lus10014757 [exp]	45.5	0.6841
					Lus10024542 [exp]	66.1	0.6805
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10024706 [exp]	69.4	0.6529
AT5G59540			2-oxoglutarate (2OG) and Fe(II...		Lus10013315 [exp]	76.5	0.6468
AT2G47810	CCAAT	NF-YB5	"nuclear factor Y, subunit B5"...		Lus10004796 [exp]	105.1	0.6384
AT2G47810	CCAAT	NF-YB5	"nuclear factor Y, subunit B5"...		Lus10036574 [exp]	105.3	0.6771
AT3G12960			unknown protein		Lus10011871 [exp]	108.8	0.6576

Compare expression of checked genes

Lus10033098 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.