Lus10033099 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62740 533 / 0 AtHIR4, ATHIR1 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT1G69840 495 / 3e-179 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
AT3G01290 475 / 2e-171 AtHIR2 hypersensitive induced reaction 2, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G51570 351 / 3e-122 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G54100 59 / 6e-10 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT4G27585 54 / 3e-08 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004268 530 / 0 AT5G62740 535 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10007268 526 / 0 AT5G62740 510 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015356 522 / 0 AT5G62740 506 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10037213 495 / 4e-179 AT1G69840 514 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10036715 493 / 2e-178 AT1G69840 516 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10038907 338 / 2e-117 AT5G51570 529 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015032 337 / 9e-117 AT5G51570 532 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10032909 61 / 3e-10 AT4G27585 498 / 4e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015597 44 / 0.0001 AT4G27585 383 / 7e-130 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G078100 523 / 0 AT5G62740 488 / 3e-176 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.017G078000 513 / 0 AT5G62740 518 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G070500 511 / 0 AT5G62740 484 / 3e-175 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G130600 347 / 1e-120 AT5G51570 510 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G129000 345 / 9e-120 AT5G51570 480 / 4e-173 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G065001 316 / 2e-109 AT5G62740 312 / 4e-108 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G005500 60 / 4e-10 AT4G27585 463 / 3e-162 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G001900 57 / 3e-09 AT4G27585 499 / 2e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0433 SPFH PF01145 Band_7 SPFH domain / Band 7 family
Representative CDS sequence
>Lus10033099 pacid=23176968 polypeptide=Lus10033099 locus=Lus10033099.g ID=Lus10033099.BGIv1.0 annot-version=v1.0
ATGGGTAATCTATTTTGCTGTGTACAAGTCGATCAATCCACTGTAGCGATAAGGGAACAATTCGGGAAGTTTGATGAAGTTCTCGAGCCTGGATGCCACT
GTCTGCCATGGTTTCTTGGGAGCCAACTAGCTGGCCATCTGTCTCTGAGAGTTCAGCAACTGGATGTTCGTTGTGAGACCAAGACAAAGGACAATGTTTT
TGTTACTGTTGTTGCTTCTGTTCAGTATCGTGCCCTGGCAGAGAGGGCAAACGATGCTTTCTACAAGCTCAGCAACACTAGGGGCCAAATCCAAGCTTAT
GTGTTTGATGTTATTAGAGCAAGTGTCCCAAAACTCAATTTGGATGATACTTTTGAGCAGAAAAATGACATCGCGAAAGCTGTAGAAGATGAACTTGAAA
AGGCTATGTCTCACTACGGCTATGAGATTGTGCAAACGCTTATTGTCGACATAGAACCGGATGAGCGTGTAAAGAAGGCAATGAATGAAATTAATGCTGC
TGCAAGAATGAGGGTGGCAGCTAATGAGAAGGCAGAGGCTGAAAAGATTCTGCAAATCAAGCGGGCTGAGGGTGAGGCTGAGTCGAAGTACCTTTCAGGG
TTGGGTATTGCTCGCCAGAGGCAAGCGATTGTTGACGGTTTAAGGGACAGTGTGCTTGGCTTTTCTTCTAATGTACCTGGGACATCTGCAAAAGATGTCA
TGGACATGGTCTTGGTTACACAGTACTTCGACACGATGAAGGAAATCGGTGCTGCCTCTAAATCCTCTGCTGTCTTTATTCCCCATGGTCCTGGTGCAGT
TCGTGACGTTGCTGCTCAGATTCGGGATGGACTTCTCCAGAGTTCTGTTGCATAA
AA sequence
>Lus10033099 pacid=23176968 polypeptide=Lus10033099 locus=Lus10033099.g ID=Lus10033099.BGIv1.0 annot-version=v1.0
MGNLFCCVQVDQSTVAIREQFGKFDEVLEPGCHCLPWFLGSQLAGHLSLRVQQLDVRCETKTKDNVFVTVVASVQYRALAERANDAFYKLSNTRGQIQAY
VFDVIRASVPKLNLDDTFEQKNDIAKAVEDELEKAMSHYGYEIVQTLIVDIEPDERVKKAMNEINAAARMRVAANEKAEAEKILQIKRAEGEAESKYLSG
LGIARQRQAIVDGLRDSVLGFSSNVPGTSAKDVMDMVLVTQYFDTMKEIGAASKSSAVFIPHGPGAVRDVAAQIRDGLLQSSVA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62740 AtHIR4, ATHIR1 hypersensitive induced reactio... Lus10033099 0 1
AT4G36160 NAC ANAC076, VND2 VASCULAR-RELATED NAC-DOMAIN 2,... Lus10015312 1.0 0.9180
AT1G25500 Plasma-membrane choline transp... Lus10041476 5.3 0.8812
AT5G45130 ATRAB-F2A, RHA1... ARABIDOPSIS RAB HOMOLOG F2A, R... Lus10040625 5.7 0.9054
AT4G17830 Peptidase M20/M25/M40 family p... Lus10040090 5.9 0.9028
AT4G17250 unknown protein Lus10028936 6.0 0.8897
AT5G03380 Heavy metal transport/detoxifi... Lus10014421 7.3 0.9148
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10022189 7.7 0.8994
AT4G19860 alpha/beta-Hydrolases superfam... Lus10018310 8.1 0.9130
AT3G03800 ATSYP131, SYP13... syntaxin of plants 131 (.1) Lus10031553 8.2 0.8789
AT4G38640 Plasma-membrane choline transp... Lus10025051 8.3 0.8611

Lus10033099 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.