Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74740 119 / 1e-33 CDPK1A, CPK30, ATCPK30 CALCIUM-DEPENDENT PROTEIN KINASE 1A, calcium-dependent protein kinase 30 (.1) AT1G18890 118 / 3e-33 CPK10, ATCDPK1, AtCPK10 calcium-dependent protein kinase 1 (.1) AT5G12480 96 / 3e-25 CPK7 calmodulin-domain protein kinase 7 (.1.2) AT3G57530 93 / 4e-24 ATCPK32, CDPK32, CPK32 calcium-dependent protein kinase 32 (.1) AT5G19450 93 / 5e-24 CPK8, CDPK19 calcium-dependent protein kinase 19 (.1.2) AT2G41860 89 / 9e-23 CPK14 calcium-dependent protein kinase 14 (.1.2) AT3G51850 88 / 2e-22 CPK13 calcium-dependent protein kinase 13 (.1) AT2G31500 62 / 4e-13 CPK24 calcium-dependent protein kinase 24 (.1) AT4G23650 40 / 2e-05 CDPK6, CPK3 Calcium dependent protein kinase 3, calcium-dependent protein kinase 6 (.1) AT1G76040 38 / 0.0001 CPK29 calcium-dependent protein kinase 29 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036667 [exp] 128 / 5e-37 AT1G18890 804 / 0.0 calcium-dependent protein kinase 1 (.1) Lus10042185 [exp] 123 / 2e-35 AT1G74740 777 / 0.0 CALCIUM-DEPENDENT PROTEIN KINASE 1A, calcium-dependent protein kinase 30 (.1) Lus10008631 [exp] 123 / 7e-35 AT1G74740 886 / 0.0 CALCIUM-DEPENDENT PROTEIN KINASE 1A, calcium-dependent protein kinase 30 (.1) Lus10014907 [exp] 94 / 2e-24 AT5G19450 896 / 0.0 calcium-dependent protein kinase 19 (.1.2) Lus10027361 [exp] 94 / 3e-24 AT5G19450 909 / 0.0 calcium-dependent protein kinase 19 (.1.2) Lus10009947 [exp] 93 / 6e-24 AT5G19450 889 / 0.0 calcium-dependent protein kinase 19 (.1.2) Lus10030134 [exp] 93 / 7e-24 AT5G19450 783 / 0.0 calcium-dependent protein kinase 19 (.1.2) Lus10002482 [exp] 89 / 2e-22 AT3G51850 979 / 0.0 calcium-dependent protein kinase 13 (.1) Lus10004807 [exp] 89 / 2e-22 AT3G51850 986 / 0.0 calcium-dependent protein kinase 13 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G066200 [exp] 119 / 2e-33 AT1G74740 918 / 0.0 CALCIUM-DEPENDENT PROTEIN KINASE 1A, calcium-dependent protein kinase 30 (.1) Potri.012G071700 [exp] 117 / 6e-33 AT1G74740 931 / 0.0 CALCIUM-DEPENDENT PROTEIN KINASE 1A, calcium-dependent protein kinase 30 (.1) Potri.006G052900 [exp] 92 / 8e-24 AT3G57530 863 / 0.0 calcium-dependent protein kinase 32 (.1) Potri.001G257100 [exp] 92 / 1e-23 AT5G12480 903 / 0.0 calmodulin-domain protein kinase 7 (.1.2) Potri.016G117200 [exp] 91 / 2e-23 AT3G51850 982 / 0.0 calcium-dependent protein kinase 13 (.1) Potri.009G052700 [exp] 91 / 4e-23 AT5G19450 903 / 0.0 calcium-dependent protein kinase 19 (.1.2) Potri.016G054600 [exp] 91 / 4e-23 AT3G57530 864 / 0.0 calcium-dependent protein kinase 32 (.1) Potri.006G101300 [exp] 87 / 4e-22 AT3G51850 977 / 0.0 calcium-dependent protein kinase 13 (.1) Potri.007G127000 [exp] 70 / 6e-16 AT2G31500 744 / 0.0 calcium-dependent protein kinase 24 (.1) Potri.001G097400 [exp] 39 / 8e-05 AT4G23650 781 / 0.0 Calcium dependent protein kinase 3, calcium-dependent protein kinase 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [flax] [poplar] EF_hand PF00036 [flax] [poplar] EF-hand_1 EF hand
Representative CDS sequence Show only first row Show all	>Lus10033107 pacid=23177031 polypeptide=Lus10033107 locus=Lus10033107.g ID=Lus10033107.BGIv1.0 annot-version=v1.0 ATGGGAGAAGTAGACACCGACAAGGACGGAAGCATTAGTTATGATGAATTTGTGACGATGATGAAAACGGGAACTGATTGGAGAAAGGCGTCGAGGCAGT ACTCAAGAGAAAGATTCAAGAGTTTGAGCCTCAACCTGTTGAAAGACGGGTCCCTACAGCTCCACGACGCACTCACTGGTGAAGCCATTGCGGTGTAG
AA sequence Show only first row Show all	>Lus10033107 pacid=23177031 polypeptide=Lus10033107 locus=Lus10033107.g ID=Lus10033107.BGIv1.0 annot-version=v1.0 MGEVDTDKDGSISYDEFVTMMKTGTDWRKASRQYSRERFKSLSLNLLKDGSLQLHDALTGEAIAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G12480		CPK7	calmodulin-domain protein kina...		Lus10033107 [exp]	0	1
					Lus10008211 [exp]	2.0	0.9427
AT5G12480		CPK7	calmodulin-domain protein kina...		Lus10033108 [exp]	3.5	0.9209
					Lus10026081 [exp]	8.0	0.9395
AT4G39230			NmrA-like negative transcripti...		Lus10040442 [exp]	10.7	0.9296
AT2G26930		CMK, CMEK, ISPE...	PIGMENT DEFECTIVE 277, 4-\(cyt...		Lus10036098 [exp]	12.7	0.9368
AT3G05200		ATL6	RING/U-box superfamily protein...		Lus10029949 [exp]	14.4	0.9238
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10001210 [exp]	21.3	0.9326
AT3G23570			alpha/beta-Hydrolases superfam...		Lus10004436 [exp]	24.0	0.8833
AT5G60600		HDS, ISPG, CSB3...	CONSTITUTIVE SUBTILISIN 3, CHL...		Lus10022583 [exp]	28.0	0.9247
AT1G65520		PEC11, ECHIC, A...	"delta\(3\), delta\(2\)-enoyl ...		Lus10005158 [exp]	30.7	0.9181

Compare expression of checked genes

Lus10033107 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.