Lus10033117 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01290 249 / 2e-83 CNX3 cofactor of nitrate reductase and xanthine dehydrogenase 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036661 382 / 6e-136 AT1G01290 265 / 1e-88 cofactor of nitrate reductase and xanthine dehydrogenase 3 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G099500 277 / 9e-95 AT1G01290 283 / 3e-96 cofactor of nitrate reductase and xanthine dehydrogenase 3 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01967 MoaC MoaC family
Representative CDS sequence
>Lus10033117 pacid=23176987 polypeptide=Lus10033117 locus=Lus10033117.g ID=Lus10033117.BGIv1.0 annot-version=v1.0
ATGGAAGTTGTCTTCGGTGAAGCTCCTCCTAGTGGACTTGCTGGTTCCATTAGCAGAGATCATCTTTCTGAACAACAGCCTCAGGTCATACCTGAAGACC
TTCCATGTTCTGTTACCAACAGCAGCTACAAACCTCACAACGCAGCAGAAGGTCAACAGGTAGCCGGTTTGACCCACATTGACCGTAAAGGAGAAGCTCA
GATGGTGGATGTGTCTCCCAAGGACTCAACCAAGAGGATTGCAGTGGCCAGTTGCAAGGTGCTACTAGGGAAGAAGGTATTTGATATGGTCCTAGCTAAC
CAAATGGCTAAAGGAGATGTCCTCACAGTGGCCAAGATTGCCGGGATCAATGGAGCAAAGCAGACCAGCACCCTGATCCCATTTTGTCATAACATTGTCT
TGAGTCATGTCCGAGTTGATCTCAAGCTGAACCCTGAGGATCACAGCGTGGATATCGAAGGGGAAGCTGCATCAATGGGGAAAACTGGAGTCGAAATGGA
AGCGCTAACGGCTGTTTCCACTGCTGGTCTAACAGTGTATGATATGTGCAAGGCTGCTTCTAAGGACATCCAGATCGTTAATATCCAGCTTGAGCGTAAA
ACCGGTGGGATAAGTGGAGATAGGTCCAGGGATAAGAAAGTTAATTAG
AA sequence
>Lus10033117 pacid=23176987 polypeptide=Lus10033117 locus=Lus10033117.g ID=Lus10033117.BGIv1.0 annot-version=v1.0
MEVVFGEAPPSGLAGSISRDHLSEQQPQVIPEDLPCSVTNSSYKPHNAAEGQQVAGLTHIDRKGEAQMVDVSPKDSTKRIAVASCKVLLGKKVFDMVLAN
QMAKGDVLTVAKIAGINGAKQTSTLIPFCHNIVLSHVRVDLKLNPEDHSVDIEGEAASMGKTGVEMEALTAVSTAGLTVYDMCKAASKDIQIVNIQLERK
TGGISGDRSRDKKVN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G01290 CNX3 cofactor of nitrate reductase ... Lus10033117 0 1
AT5G57370 unknown protein Lus10006974 4.9 0.8326
AT1G64550 SCORD5, AtGCN20... susceptible to coronatine-defi... Lus10032431 11.1 0.8127
AT5G61400 Pentatricopeptide repeat (PPR)... Lus10019081 11.5 0.7719
AT5G49400 zinc knuckle (CCHC-type) famil... Lus10037744 19.6 0.7946
AT5G49400 zinc knuckle (CCHC-type) famil... Lus10037745 19.7 0.8002
AT1G60670 Protein of unknown function (D... Lus10012911 21.8 0.7841
AT5G64830 programmed cell death 2 C-term... Lus10021075 25.8 0.7285
AT4G27680 P-loop containing nucleoside t... Lus10022361 26.5 0.7411
AT3G26810 AFB2 auxin signaling F-box 2 (.1) Lus10035160 28.5 0.7359
AT1G68550 AP2_ERF CRF10 cytokinin response factor 10, ... Lus10041456 29.8 0.7067

Lus10033117 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.