Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17930 37 / 0.0003 Aminotransferase-like, plant mobile domain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015702 [exp] 129 / 1e-39 ND 38 / 0.004 Lus10017181 [exp] 127 / 2e-39 ND / Lus10007197 [exp] 125 / 2e-39 ND / Lus10032804 [exp] 126 / 1e-38 ND / Lus10012087 [exp] 125 / 1e-37 AT1G17930 57 / 4e-09 Aminotransferase-like, plant mobile domain family protein (.1) Lus10010402 [exp] 121 / 8e-37 ND / Lus10034059 [exp] 119 / 1e-36 AT1G48120 43 / 1e-05 hydrolases;protein serine/threonine phosphatases (.1) Lus10040026 [exp] 115 / 4e-35 AT1G48120 45 / 3e-06 hydrolases;protein serine/threonine phosphatases (.1) Lus10000686 [exp] 115 / 5e-34 AT1G17930 87 / 3e-20 Aminotransferase-like, plant mobile domain family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10536 [flax] [poplar] PMD Plant mobile domain
Representative CDS sequence Show only first row Show all	>Lus10033138 pacid=23178103 polypeptide=Lus10033138 locus=Lus10033138.g ID=Lus10033138.BGIv1.0 annot-version=v1.0 ATGGATTCTCGTGATGTGAGTTGGCTTCCTTTTGGGCCGCATCTGGACATTGAGGTCCCCGCGTCGATTTTCCGTGATCTCATCTGTTGCGCCGACATAT GTGACTACTACGATTCCTATCGTGTGCTCCGACAGTTTGGGTACACACAGGTGGTCCCTCCCTCGATTCCTGTGCCGCTGCGGGCCATGAGGCCCAAATC TATCCGGACATATGCGGTCCAGTGA
AA sequence Show only first row Show all	>Lus10033138 pacid=23178103 polypeptide=Lus10033138 locus=Lus10033138.g ID=Lus10033138.BGIv1.0 annot-version=v1.0 MDSRDVSWLPFGPHLDIEVPASIFRDLICCADICDYYDSYRVLRQFGYTQVVPPSIPVPLRAMRPKSIRTYAVQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10033138 [exp]	0	1
AT5G60920		COB	COBRA-like extracellular glyco...		Lus10017861 [exp]	15.4	0.7059
					Lus10010449 [exp]	19.2	0.6937
AT3G29390		RIK	RS2-interacting KH protein (.1...		Lus10032979 [exp]	26.5	0.6390
AT4G34150			Calcium-dependent lipid-bindin...		Lus10002825 [exp]	28.0	0.6927
AT1G54140		TAF9, TAFII21	TBP-ASSOCIATED FACTOR 9, TATA ...		Lus10022103 [exp]	32.9	0.6640
AT1G11290		CRR22	CHLORORESPIRATORY REDUCTION22,...		Lus10004304 [exp]	38.4	0.6602
AT5G48840		ATPTS, PANC	ARABIDOPSIS THALIANA PANTOTHEN...		Lus10038167 [exp]	38.8	0.6381
					Lus10000458 [exp]	46.1	0.6294
AT1G19780		ATCNGC8	cyclic nucleotide gated channe...		Lus10041662 [exp]	51.2	0.6284
AT3G10530			Transducin/WD40 repeat-like su...		Lus10024656 [exp]	65.4	0.6383

Compare expression of checked genes

Lus10033138 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.