Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75750 81 / 2e-21 GASA1 GAST1 protein homolog 1 (.1.2) AT2G18420 81 / 2e-21 Gibberellin-regulated family protein (.1) AT4G09600 80 / 5e-21 GASA3 GAST1 protein homolog 3 (.1) AT1G22690 77 / 1e-19 Gibberellin-regulated family protein (.1.2.3) AT4G09610 64 / 1e-14 GASA2 GAST1 protein homolog 2 (.1) AT1G74670 64 / 1e-14 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT5G14920 65 / 1e-13 Gibberellin-regulated family protein (.1.2) AT1G10588 61 / 1e-13 Gibberellin-regulated family protein (.1.2) AT2G39540 60 / 4e-13 Gibberellin-regulated family protein (.1) AT5G15230 59 / 1e-12 GASA4 GAST1 protein homolog 4 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034524 [exp] 175 / 2e-58 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2) Lus10017212 [exp] 79 / 1e-20 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2) Lus10009421 [exp] 79 / 2e-19 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3) Lus10025962 [exp] 68 / 5e-16 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1) Lus10014262 [exp] 67 / 1e-15 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1) Lus10039443 [exp] 65 / 2e-14 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2) Lus10018708 [exp] 58 / 2e-12 AT5G59845 114 / 8e-35 Gibberellin-regulated family protein (.1) Lus10024338 [exp] 58 / 5e-12 ND 78 / 3e-20 Lus10001407 [exp] 57 / 6e-12 AT5G59845 95 / 6e-27 Gibberellin-regulated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G113400 [exp] 93 / 3e-26 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.005G239100 [exp] 88 / 3e-24 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2) Potri.002G022600 [exp] 86 / 2e-23 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2) Potri.005G239000 [exp] 86 / 2e-23 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1) Potri.002G022500 [exp] 85 / 1e-22 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.002G022700 [exp] 81 / 2e-21 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2) Potri.012G076700 [exp] 80 / 9e-21 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1) Potri.015G071500 [exp] 79 / 3e-20 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2) Potri.019G083900 [exp] 74 / 2e-18 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3) Potri.001G350600 [exp] 71 / 3e-16 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10033145 pacid=23178079 polypeptide=Lus10033145 locus=Lus10033145.g ID=Lus10033145.BGIv1.0 annot-version=v1.0 ATGGCGACTGGATTCCGAGCGCATGCCATGGTTTGCCTTCTCTTCATCCTCATTCCACTTCTCGCCCAACCCCATCAATACATCCCCGCCGACTCCAAGA GCTATGAATTCGCAACTCATGGTGCCGGCTTTCTTGCGAAAATGGGGAGGTGCCGGTTAGCGTCGAGGCATCGGATGTGCATTAGGGCATGCGGAACTTG CTGTGCAAGGTGCAATTGTGTGCCACCGGGCACCTCAGGAAACAGAGAAGTGTGCCCCTGCTACGCCAAGATGACTACCCACGGCGGAAGGCTCAAGTGT CCTTAA
AA sequence Show only first row Show all	>Lus10033145 pacid=23178079 polypeptide=Lus10033145 locus=Lus10033145.g ID=Lus10033145.BGIv1.0 annot-version=v1.0 MATGFRAHAMVCLLFILIPLLAQPHQYIPADSKSYEFATHGAGFLAKMGRCRLASRHRMCIRACGTCCARCNCVPPGTSGNREVCPCYAKMTTHGGRLKC P

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75750		GASA1	GAST1 protein homolog 1 (.1.2)		Lus10033145 [exp]	0	1

Compare expression of checked genes

Lus10033145 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.