Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034523 [exp] 103 / 4e-29 AT1G75717 45 / 1e-06 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G238400 [exp] 48 / 4e-08 AT1G75717 52 / 1e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033147 pacid=23178040 polypeptide=Lus10033147 locus=Lus10033147.g ID=Lus10033147.BGIv1.0 annot-version=v1.0 ATGAAGTTGTTCAATCGGTTCCGTAAGATTCTGGTGGGACTCTTATTCTCCAGTACTACACCTTCTGCCTATCGCGACGGCAGCGGAGGACGGAAGCAAG GGCGGCGTCGTAGCAGTGACCGTCACTCGTCGGCGGAGGACCCACCGAAAATATCGTGCAGCAGCAGCTCAGTGTATAATTACTCGACTCAGTTGCATTA CAGTGAGGCGGTTGCTGACTGCATTGAGTTCTTGAACAAGTCCAGCTCTGCCTCCTCCACGCCTGCTACTACTACTCACGACGATGATGATCATGGGTAC GATGGACGTGTTTGGGTTTGA
AA sequence Show only first row Show all	>Lus10033147 pacid=23178040 polypeptide=Lus10033147 locus=Lus10033147.g ID=Lus10033147.BGIv1.0 annot-version=v1.0 MKLFNRFRKILVGLLFSSTTPSAYRDGSGGRKQGRRRSSDRHSSAEDPPKISCSSSSVYNYSTQLHYSEAVADCIEFLNKSSSASSTPATTTHDDDDHGY DGRVWV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75717			unknown protein		Lus10033147 [exp]	0	1
AT2G24400			SAUR-like auxin-responsive pro...		Lus10035716 [exp]	12.9	0.8971
AT5G42500			Disease resistance-responsive ...		Lus10021084 [exp]	14.9	0.8670
AT4G12470		AZI1	azelaic acid induced 1 (.1)		Lus10032261 [exp]	15.7	0.8911
AT3G52440	DOF	AtDof3,5	Dof-type zinc finger DNA-bindi...		Lus10021266 [exp]	16.3	0.8770
AT4G21105			cytochrome-c oxidases;electron...		Lus10006275 [exp]	26.0	0.8895
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10038057 [exp]	29.5	0.8849
AT3G24750			unknown protein		Lus10038162 [exp]	30.5	0.8864
AT3G24750			unknown protein		Lus10025939 [exp]	38.7	0.8832
AT2G02310		ATPP2-B6	phloem protein 2-B6 (.1)		Lus10003445 [exp]	39.5	0.8517
AT5G14920			Gibberellin-regulated family p...		Lus10032168 [exp]	40.3	0.8742

Compare expression of checked genes

Lus10033147 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.