Lus10033155 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G31790 129 / 1e-37 Tetrapyrrole (Corrin/Porphyrin) Methylases (.1), Tetrapyrrole (Corrin/Porphyrin) Methylases (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034516 159 / 3e-49 AT4G31790 442 / 1e-158 Tetrapyrrole (Corrin/Porphyrin) Methylases (.1), Tetrapyrrole (Corrin/Porphyrin) Methylases (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G023700 139 / 9e-42 AT4G31790 466 / 6e-168 Tetrapyrrole (Corrin/Porphyrin) Methylases (.1), Tetrapyrrole (Corrin/Porphyrin) Methylases (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Representative CDS sequence
>Lus10033155 pacid=23178073 polypeptide=Lus10033155 locus=Lus10033155.g ID=Lus10033155.BGIv1.0 annot-version=v1.0
ATGCTGTACATAATAGGATTGGGATTGGGCGACGAGAAGGACATCACTCTACGAGGTCTAGAAGCAGTGAAGAAATGCGATAAAGTGTTCGTCGAAGTCT
ACACTTCTCTTCTCTCCTTTGGCCTTTCCTCCGACGGAATCTCAACTCTCCCGATAGAGAGAGCCGATAGAGAGATGGTGGAAGAGAAGGCCGACGAGAT
TCTGTCCGACGCTCGTACATCCGACGTCGCCTTCCTTGTCGTCGGAGATCCCTTCGGATATTCGAGTGAAGAGCCTACATGGGAGTCTTTGTCGAGAGGG
AAGAAGAAGTATGAACCACCGAGGTACATGACGATAAACACTGCAATTGAGCAGCTACTGGAAGTCGTTCAGAATCGTGGAAGATCTGGTATGTAA
AA sequence
>Lus10033155 pacid=23178073 polypeptide=Lus10033155 locus=Lus10033155.g ID=Lus10033155.BGIv1.0 annot-version=v1.0
MLYIIGLGLGDEKDITLRGLEAVKKCDKVFVEVYTSLLSFGLSSDGISTLPIERADREMVEEKADEILSDARTSDVAFLVVGDPFGYSSEEPTWESLSRG
KKKYEPPRYMTINTAIEQLLEVVQNRGRSGM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G31790 Tetrapyrrole (Corrin/Porphyrin... Lus10033155 0 1
AT1G80000 CASC3/Barentsz eIF4AIII bindin... Lus10011468 13.0 0.7561
AT1G56290 CwfJ-like family protein (.1) Lus10022209 13.3 0.7752
AT5G17370 Transducin/WD40 repeat-like su... Lus10001227 18.2 0.7578
AT2G26790 Pentatricopeptide repeat (PPR)... Lus10005692 18.7 0.7281
AT1G55250 HUB2, HISTONEMO... histone mono-ubiquitination 2 ... Lus10041689 20.0 0.7645
AT1G17720 ATBBETA, ATB BE... Protein phosphatase 2A, regula... Lus10015635 24.5 0.7209
AT5G42920 AtTHO5 THO complex, subunit 5 (.1.2) Lus10009754 28.7 0.7521
AT5G58100 unknown protein Lus10008552 37.6 0.7291
AT3G46220 unknown protein Lus10004920 40.9 0.7262
AT3G26610 Pectin lyase-like superfamily ... Lus10029121 51.7 0.6975

Lus10033155 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.