Lus10033161 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75590 188 / 3e-62 SAUR-like auxin-responsive protein family (.1)
AT5G10990 177 / 4e-58 SAUR-like auxin-responsive protein family (.1)
AT1G19840 166 / 8e-54 SAUR-like auxin-responsive protein family (.1)
AT4G34750 146 / 1e-45 SAUR-like auxin-responsive protein family (.1.2)
AT4G34760 81 / 2e-20 SAUR-like auxin-responsive protein family (.1)
AT2G24400 82 / 3e-20 SAUR-like auxin-responsive protein family (.1)
AT5G20810 81 / 9e-20 SAUR-like auxin-responsive protein family (.1.2)
AT3G43120 80 / 1e-19 SAUR-like auxin-responsive protein family (.1)
AT2G21220 78 / 2e-19 SAUR-like auxin-responsive protein family (.1)
AT4G34770 76 / 1e-18 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034507 291 / 6e-103 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10012426 203 / 3e-68 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1)
Lus10024322 170 / 2e-55 AT1G75590 152 / 3e-48 SAUR-like auxin-responsive protein family (.1)
Lus10012190 133 / 2e-40 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2)
Lus10042374 130 / 2e-39 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1)
Lus10026297 130 / 3e-39 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Lus10021130 88 / 3e-23 AT4G34750 97 / 8e-27 SAUR-like auxin-responsive protein family (.1.2)
Lus10017179 86 / 2e-22 AT4G34750 89 / 6e-24 SAUR-like auxin-responsive protein family (.1.2)
Lus10034888 77 / 2e-18 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G024500 210 / 5e-71 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1)
Potri.005G237000 209 / 1e-70 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1)
Potri.004G164300 171 / 8e-56 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1)
Potri.009G125900 169 / 6e-55 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1)
Potri.006G126500 82 / 7e-21 AT2G37030 131 / 1e-40 SAUR-like auxin-responsive protein family (.1)
Potri.016G091500 82 / 9e-21 AT2G37030 136 / 2e-42 SAUR-like auxin-responsive protein family (.1)
Potri.018G063400 81 / 5e-20 AT5G20810 219 / 3e-74 SAUR-like auxin-responsive protein family (.1.2)
Potri.018G132400 80 / 1e-19 AT3G43120 64 / 2e-13 SAUR-like auxin-responsive protein family (.1)
Potri.009G127400 77 / 4e-19 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Potri.008G037900 78 / 5e-19 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10033161 pacid=23178032 polypeptide=Lus10033161 locus=Lus10033161.g ID=Lus10033161.BGIv1.0 annot-version=v1.0
ATGTCTGCCGGACTCTCCAAATGCGCCAAAATCCGCCACATTGTGAAGCTTCGCCAAATGCTCCGACGTTGGAGGAACAAGGCAAGGATATCATCATCAC
TCAACAGGACCACCGCCGCCCCTTCCGACGTCCCCTCCGGCCACGTCGCCATCTACGTCGGAATCACCTCTCGCCGGTTCGTCGTCCGAGCCACTCACCT
CAATCACCCGATTTTTAAGAAACTCCTCATCCAGGCCGAGGAGGAGTACGGTTTCTCCAACCACGGTCCTCTCACCATCCCCTGCGACGAGTCCTTGTTT
GAGGAAGCGATCCGGTACATTTCCAGATCCGAATCCGGGAAATCCACGACCCGGATCGTGAGTCTCGAGGATCTAGTCAAGAACTGCCGCAACATTGGGA
TCGATTTGTGGACCGAGTCTCGGCCGCTTCTTGCCGAGTAA
AA sequence
>Lus10033161 pacid=23178032 polypeptide=Lus10033161 locus=Lus10033161.g ID=Lus10033161.BGIv1.0 annot-version=v1.0
MSAGLSKCAKIRHIVKLRQMLRRWRNKARISSSLNRTTAAPSDVPSGHVAIYVGITSRRFVVRATHLNHPIFKKLLIQAEEEYGFSNHGPLTIPCDESLF
EEAIRYISRSESGKSTTRIVSLEDLVKNCRNIGIDLWTESRPLLAE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G75590 SAUR-like auxin-responsive pro... Lus10033161 0 1
AT1G02570 unknown protein Lus10025023 6.0 0.8499
AT1G08280 Glycosyltransferase family 29 ... Lus10019538 6.1 0.8634
AT3G13772 AtTMN7 transmembrane nine 7 (.1) Lus10037643 10.0 0.8564
AT1G74030 ENO1 enolase 1 (.1) Lus10038963 17.5 0.8425
AT2G17980 ATSLY1 Sec1/munc18-like (SM) proteins... Lus10023936 18.1 0.8482
AT4G35300 TMT2 tonoplast monosaccharide trans... Lus10022989 21.2 0.8277
AT5G48560 bHLH bHLH078 basic helix-loop-helix (bHLH) ... Lus10002337 22.1 0.8224
AT2G17980 ATSLY1 Sec1/munc18-like (SM) proteins... Lus10014435 25.8 0.8390
AT1G80690 PPPDE putative thiol peptidase... Lus10026215 26.1 0.8288
AT1G48270 GCR1 G-protein-coupled receptor 1 (... Lus10018333 26.2 0.8081

Lus10033161 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.