Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036312 [exp] 80 / 1e-18 AT5G08020 67 / 3e-11 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1) Lus10009515 [exp] 63 / 5e-13 ND / Lus10001304 [exp] 57 / 2e-10 AT5G08020 40 / 0.006 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1) Lus10010883 [exp] 49 / 9e-08 ND / Lus10020633 [exp] 43 / 1e-05 ND / Lus10000293 [exp] 42 / 3e-05 ND 48 / 2e-05 Lus10009514 [exp] 0 / 1 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033171 pacid=23178078 polypeptide=Lus10033171 locus=Lus10033171.g ID=Lus10033171.BGIv1.0 annot-version=v1.0 ATGTTCACTCATCATATTGTAAGCCCTCCAAGTACTCATACCACACCTTTGCTAGGTGACCCCGAGTCTGTTGCTCCTGTACCAACTTACACTCCCTTGC AGGCATCACCATCCCGTGTCGCTCATGAACTTTCGTTGGCTTATTATTCCCTTATTTTCCTCTCTCAACCTGCATCCCCTTCACTATCTGAGGATGACCA GCCCCTCTCCAAGGAGCAGGTTCTCGAGCATGTAGATTTCATCATGCATGCTGGCTATGACTATATGAAAAAATGGGGGGCTGCTTTGAGTGCACTTGAT GGTCCGCCTGTGTTTGGACTCGATGCATCCTCGACTGATGTTTTGTCCAAGTCGAAAGTGAGTTAA
AA sequence Show only first row Show all	>Lus10033171 pacid=23178078 polypeptide=Lus10033171 locus=Lus10033171.g ID=Lus10033171.BGIv1.0 annot-version=v1.0 MFTHHIVSPPSTHTTPLLGDPESVAPVPTYTPLQASPSRVAHELSLAYYSLIFLSQPASPSLSEDDQPLSKEQVLEHVDFIMHAGYDYMKKWGAALSALD GPPVFGLDASSTDVLSKSKVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10033171 [exp]	0	1
AT1G18720			Protein of unknown function (D...		Lus10001647 [exp]	4.2	1.0000
					Lus10010414 [exp]	5.3	1.0000
					Lus10025056 [exp]	6.3	1.0000
AT2G22620			Rhamnogalacturonate lyase fami...		Lus10010628 [exp]	6.5	1.0000
					Lus10010663 [exp]	7.2	1.0000
AT3G26140			Cellulase (glycosyl hydrolase ...		Lus10032312 [exp]	9.4	1.0000
AT2G23810		TET8	tetraspanin8 (.1)		Lus10027256 [exp]	9.5	1.0000
					Lus10014229 [exp]	10.2	1.0000
AT2G39518			Uncharacterised protein family...		Lus10031304 [exp]	10.8	1.0000
AT4G03230			S-locus lectin protein kinase ...		Lus10031602 [exp]	11.4	1.0000

Compare expression of checked genes

Lus10033171 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.