Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23960 81 / 4e-19 ATTPS21 terpene synthase 21 (.1.2) AT5G48110 64 / 4e-13 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT1G70080 63 / 6e-13 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT3G32030 59 / 2e-11 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT4G20200 56 / 3e-10 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT3G14540 54 / 1e-09 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT3G14520 53 / 3e-09 AtTPS18 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT1G31950 52 / 5e-09 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT3G29410 52 / 6e-09 AtTPS25 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT1G33750 51 / 9e-09 AtTPS22 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033189 [exp] 211 / 9e-73 AT5G23960 81 / 5e-19 terpene synthase 21 (.1.2) Lus10040043 [exp] 91 / 9e-23 AT5G23960 329 / 7e-106 terpene synthase 21 (.1.2) Lus10031590 [exp] 90 / 2e-22 AT5G23960 378 / 3e-125 terpene synthase 21 (.1.2) Lus10008611 [exp] 89 / 9e-22 AT5G23960 348 / 4e-113 terpene synthase 21 (.1.2) Lus10002660 [exp] 88 / 1e-21 AT3G14520 310 / 4e-98 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10042202 [exp] 86 / 5e-21 AT5G23960 302 / 8e-96 terpene synthase 21 (.1.2) Lus10008614 [exp] 86 / 5e-21 AT5G23960 345 / 1e-112 terpene synthase 21 (.1.2) Lus10042204 [exp] 85 / 1e-20 AT5G23960 347 / 4e-113 terpene synthase 21 (.1.2) Lus10014724 [exp] 81 / 4e-19 AT5G23960 314 / 2e-100 terpene synthase 21 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G142800 [exp] 111 / 6e-30 AT5G23960 405 / 2e-135 terpene synthase 21 (.1.2) Potri.015G032100 [exp] 97 / 5e-25 AT5G23960 444 / 8e-151 terpene synthase 21 (.1.2) Potri.015G085500 [exp] 97 / 6e-25 AT5G23960 456 / 1e-155 terpene synthase 21 (.1.2) Potri.005G095500 [exp] 94 / 1e-23 AT5G23960 408 / 6e-137 terpene synthase 21 (.1.2) Potri.019G045300 [exp] 84 / 3e-20 AT5G23960 416 / 3e-140 terpene synthase 21 (.1.2) Potri.019G020367 [exp] 82 / 1e-19 AT5G23960 494 / 7e-171 terpene synthase 21 (.1.2) Potri.019G016118 [exp] 80 / 1e-19 AT5G23960 197 / 1e-59 terpene synthase 21 (.1.2) Potri.019G044900 [exp] 81 / 3e-19 AT5G23960 342 / 8e-112 terpene synthase 21 (.1.2) Potri.019G016500 [exp] 80 / 7e-19 AT5G23960 463 / 6e-159 terpene synthase 21 (.1.2) Potri.019G016400 [exp] 79 / 2e-18 AT5G23960 436 / 5e-148 terpene synthase 21 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0613 [flax] [poplar] Terp_synthase PF03936 [flax] [poplar] Terpene_synth_C Terpene synthase family, metal binding domain
Representative CDS sequence Show only first row Show all	>Lus10033188 pacid=23178080 polypeptide=Lus10033188 locus=Lus10033188.g ID=Lus10033188.BGIv1.0 annot-version=v1.0 ATGGGATACCTAACGGAGGCAAAGTGGAGGGATGAAGAGTATTGTCCAAAGCTAGAAGAGTACATACAAGTTTCACTCCTCACCACTTGCTATCCACTGC TTGCAACCATGTCATTCGTTGGCATGCCCCAATCCGGAACGAACGACACCTTTGATTGGATCTCCGGTGCTCCCGCTATAATCAACGTATCCACAATCGT CTGCAGGACAATGGATGCTATTGTCTCTCATGAGTTTGAGCAACAGAGGAAGCACATCCCCTCAGCTGTGGAGCTATACATGGAGAAGCACAAGGTCTAA
AA sequence Show only first row Show all	>Lus10033188 pacid=23178080 polypeptide=Lus10033188 locus=Lus10033188.g ID=Lus10033188.BGIv1.0 annot-version=v1.0 MGYLTEAKWRDEEYCPKLEEYIQVSLLTTCYPLLATMSFVGMPQSGTNDTFDWISGAPAIINVSTIVCRTMDAIVSHEFEQQRKHIPSAVELYMEKHKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10033188 [exp]	0	1
AT3G19270		CYP707A4	"cytochrome P450, family 707, ...		Lus10014056 [exp]	4.6	0.8266
AT1G59960			NAD(P)-linked oxidoreductase s...		Lus10040101 [exp]	6.0	0.7598
AT3G53710		AGD6	ARF-GAP domain 6 (.1.2)		Lus10012991 [exp]	6.5	0.8266
AT5G44265			Bifunctional inhibitor/lipid-t...		Lus10033667 [exp]	6.9	0.7833
AT1G13570			F-box/RNI-like superfamily pro...		Lus10020638 [exp]	7.1	0.7653
AT2G43870			Pectin lyase-like superfamily ...		Lus10011417 [exp]	7.9	0.8266
AT3G05950			RmlC-like cupins superfamily p...		Lus10023351 [exp]	9.2	0.8266
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10033189 [exp]	10.2	0.8266
AT2G28630		KCS12	3-ketoacyl-CoA synthase 12 (.1...		Lus10033628 [exp]	11.2	0.8266
					Lus10002332 [exp]	12.1	0.8266

Compare expression of checked genes

Lus10033188 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.