Lus10033189 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G23960 81 / 4e-19 ATTPS21 terpene synthase 21 (.1.2)
AT5G48110 64 / 4e-13 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT1G70080 63 / 6e-13 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT3G32030 59 / 2e-11 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT4G20200 56 / 3e-10 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT3G14540 54 / 1e-09 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT3G14520 53 / 3e-09 AtTPS18 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT1G31950 52 / 5e-09 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT3G29410 52 / 6e-09 AtTPS25 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT1G33750 51 / 9e-09 AtTPS22 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033188 211 / 9e-73 AT5G23960 81 / 5e-19 terpene synthase 21 (.1.2)
Lus10040043 91 / 9e-23 AT5G23960 329 / 7e-106 terpene synthase 21 (.1.2)
Lus10031590 90 / 2e-22 AT5G23960 378 / 3e-125 terpene synthase 21 (.1.2)
Lus10008611 89 / 9e-22 AT5G23960 348 / 4e-113 terpene synthase 21 (.1.2)
Lus10002660 88 / 1e-21 AT3G14520 310 / 4e-98 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Lus10042202 86 / 5e-21 AT5G23960 302 / 8e-96 terpene synthase 21 (.1.2)
Lus10008614 86 / 5e-21 AT5G23960 345 / 1e-112 terpene synthase 21 (.1.2)
Lus10042204 85 / 1e-20 AT5G23960 347 / 4e-113 terpene synthase 21 (.1.2)
Lus10014724 81 / 4e-19 AT5G23960 314 / 2e-100 terpene synthase 21 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G142800 111 / 6e-30 AT5G23960 405 / 2e-135 terpene synthase 21 (.1.2)
Potri.015G032100 97 / 5e-25 AT5G23960 444 / 8e-151 terpene synthase 21 (.1.2)
Potri.015G085500 97 / 6e-25 AT5G23960 456 / 1e-155 terpene synthase 21 (.1.2)
Potri.005G095500 94 / 1e-23 AT5G23960 408 / 6e-137 terpene synthase 21 (.1.2)
Potri.019G045300 84 / 3e-20 AT5G23960 416 / 3e-140 terpene synthase 21 (.1.2)
Potri.019G020367 82 / 1e-19 AT5G23960 494 / 7e-171 terpene synthase 21 (.1.2)
Potri.019G016118 80 / 1e-19 AT5G23960 197 / 1e-59 terpene synthase 21 (.1.2)
Potri.019G044900 81 / 3e-19 AT5G23960 342 / 8e-112 terpene synthase 21 (.1.2)
Potri.019G016500 80 / 7e-19 AT5G23960 463 / 6e-159 terpene synthase 21 (.1.2)
Potri.019G016400 79 / 2e-18 AT5G23960 436 / 5e-148 terpene synthase 21 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0613 Terp_synthase PF03936 Terpene_synth_C Terpene synthase family, metal binding domain
Representative CDS sequence
>Lus10033189 pacid=23178065 polypeptide=Lus10033189 locus=Lus10033189.g ID=Lus10033189.BGIv1.0 annot-version=v1.0
ATGGGATACCTAACGGAGGCAAAGTGGAGGGATGAAGAGTATTGTCCAAAGCTAGAAGAGTACATACAAGTTTCACTCCTCACCACTTGCTATCCACTGC
TTGCAACCATGTCATTCGTTGGCATGCCCCAATCCGGAACGAACGACACCTTTGATTGGATCTCCGGTGCTCCCGCTATAATCAACGTATCCACAATCGT
CTGCAGGACAATGGATGCTATTGTCTCTCATGAGTTTGAGCAACAGAGGAAGCACATCCCCTCAGCTGTGGAGCTATACATGGAGAAGCACAAGGTCTAA
AA sequence
>Lus10033189 pacid=23178065 polypeptide=Lus10033189 locus=Lus10033189.g ID=Lus10033189.BGIv1.0 annot-version=v1.0
MGYLTEAKWRDEEYCPKLEEYIQVSLLTTCYPLLATMSFVGMPQSGTNDTFDWISGAPAIINVSTIVCRTMDAIVSHEFEQQRKHIPSAVELYMEKHKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Lus10033189 0 1
Lus10002332 2.6 1.0000
AT1G02335 GL22 germin-like protein subfamily ... Lus10004856 3.7 1.0000
AT2G43870 Pectin lyase-like superfamily ... Lus10011417 4.6 1.0000
AT3G05950 RmlC-like cupins superfamily p... Lus10023351 5.3 1.0000
AT3G53710 AGD6 ARF-GAP domain 6 (.1.2) Lus10012991 5.9 1.0000
AT3G19270 CYP707A4 "cytochrome P450, family 707, ... Lus10014056 6.5 1.0000
AT1G17930 Aminotransferase-like, plant m... Lus10031075 7.0 1.0000
AT2G28630 KCS12 3-ketoacyl-CoA synthase 12 (.1... Lus10033628 8.0 1.0000
AT4G35500 Protein kinase superfamily pro... Lus10035984 8.4 0.9586
AT2G31750 UGT74D1 UDP-glucosyl transferase 74D1 ... Lus10009409 8.5 1.0000

Lus10033189 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.