Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G44970 140 / 1e-41 Peroxidase superfamily protein (.1) AT2G18150 133 / 5e-39 Peroxidase superfamily protein (.1) AT2G18140 130 / 4e-38 Peroxidase superfamily protein (.1) AT4G36430 127 / 9e-37 Peroxidase superfamily protein (.1) AT5G66390 123 / 3e-35 Peroxidase superfamily protein (.1) AT3G50990 114 / 1e-31 Peroxidase superfamily protein (.1) AT2G35380 99 / 2e-26 Peroxidase superfamily protein (.1.2) AT5G06730 92 / 4e-23 Peroxidase superfamily protein (.1) AT5G19890 91 / 5e-23 Peroxidase superfamily protein (.1) AT5G58400 90 / 1e-22 Peroxidase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010634 [exp] 214 / 2e-70 AT1G44970 449 / 5e-159 Peroxidase superfamily protein (.1) Lus10041784 [exp] 138 / 6e-41 AT5G66390 519 / 0.0 Peroxidase superfamily protein (.1) Lus10009899 [exp] 98 / 2e-25 AT1G14550 367 / 2e-127 Peroxidase superfamily protein (.1) Lus10024207 [exp] 97 / 2e-25 AT1G14550 322 / 2e-110 Peroxidase superfamily protein (.1) Lus10029094 [exp] 97 / 4e-25 AT1G68850 439 / 1e-155 Peroxidase superfamily protein (.1) Lus10034207 [exp] 97 / 5e-25 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1) Lus10030148 [exp] 94 / 4e-24 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1) Lus10029062 [exp] 94 / 5e-24 AT5G05340 292 / 1e-98 Peroxidase superfamily protein (.1) Lus10013065 [exp] 94 / 8e-24 AT1G68850 431 / 2e-152 Peroxidase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G031200 [exp] 149 / 3e-45 AT1G44970 492 / 6e-176 Peroxidase superfamily protein (.1) Potri.007G019300 [exp] 136 / 4e-40 AT5G66390 507 / 0.0 Peroxidase superfamily protein (.1) Potri.005G118700 [exp] 134 / 2e-39 AT5G66390 504 / 0.0 Peroxidase superfamily protein (.1) Potri.001G145800 [exp] 109 / 6e-30 AT2G35380 458 / 6e-163 Peroxidase superfamily protein (.1.2) Potri.016G132800 [exp] 100 / 3e-26 AT5G05340 336 / 3e-115 Peroxidase superfamily protein (.1) Potri.010G134500 [exp] 97 / 3e-25 AT1G68850 459 / 2e-163 Peroxidase superfamily protein (.1) Potri.013G154400 [exp] 96 / 6e-25 AT5G05340 363 / 3e-126 Peroxidase superfamily protein (.1) Potri.013G083600 [exp] 95 / 1e-24 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1) Potri.008G110600 [exp] 95 / 2e-24 AT1G68850 488 / 9e-175 Peroxidase superfamily protein (.1) Potri.016G132900 [exp] 94 / 4e-24 AT5G05340 350 / 6e-121 Peroxidase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0617 [flax] [poplar] Peroxidase PF00141 [flax] [poplar] peroxidase Peroxidase
Representative CDS sequence Show only first row Show all	>Lus10033193 pacid=23178068 polypeptide=Lus10033193 locus=Lus10033193.g ID=Lus10033193.BGIv1.0 annot-version=v1.0 ATGACGTTCAAGCAGAGACTGTACAGCCAAAAGGGTCCGGACCTGAGTTCGAAGAGGACTTACTGCATTGGGTTGAAGTCGGGCTGTCCTAGATCGGGCG GTGACAACAACATTAGCCCTCTCGATTTCGGTTCCCCTGCCAGATTCGACAACACCTACTTCAACCTCATCCTGCGGGGCAAAGTCCTCCTCACTTCGGA CCAAGTTCTGTTCACGTTTCAGTTGGTGAAGAGATATGCTGAGGACCAGCAACTTTTCTTTGCTCAATTCACCAAGTCCATGGTCAGAATGGGGAGCGTC GGTGTTCTCACTGGCTTTAAGGGTGAAGTTCGCAAGAACTGTCGTCGTCTCAACTAA
AA sequence Show only first row Show all	>Lus10033193 pacid=23178068 polypeptide=Lus10033193 locus=Lus10033193.g ID=Lus10033193.BGIv1.0 annot-version=v1.0 MTFKQRLYSQKGPDLSSKRTYCIGLKSGCPRSGGDNNISPLDFGSPARFDNTYFNLILRGKVLLTSDQVLFTFQLVKRYAEDQQLFFAQFTKSMVRMGSV GVLTGFKGEVRKNCRRLN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G44970			Peroxidase superfamily protein...		Lus10033193 [exp]	0	1
AT2G39200		ATMLO12, MLO12	MILDEW RESISTANCE LOCUS O 12, ...		Lus10040388 [exp]	16.1	0.8145
					Lus10008694 [exp]	20.9	0.7686
AT3G12120		FAD2	fatty acid desaturase 2 (.1.2)		Lus10004178 [exp]	31.1	0.7273
AT1G13590		ATPSK1	phytosulfokine 1 precursor (.1...		Lus10030572 [exp]	46.8	0.7592
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10016353 [exp]	62.8	0.7341
AT2G24100		ASG1	ALTERED SEED GERMINATION 1, un...		Lus10010920 [exp]	89.5	0.7000
					Lus10008695 [exp]	134.0	0.7119
					Lus10007078 [exp]	150.9	0.6785
AT4G14660		NRPE7	RNA polymerase Rpb7-like, N-te...		Lus10023620 [exp]	233.7	0.6655
AT2G23560		ATMES7	ARABIDOPSIS THALIANA METHYL ES...		Lus10000840 [exp]	274.2	0.6607

Compare expression of checked genes

Lus10033193 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.