Lus10033195 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04940 341 / 7e-119 AtTic20-I, atTIC20, TIC20 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
AT1G04945 301 / 1e-98 HIT-type Zinc finger family protein (.1.2.3)
AT4G03320 160 / 4e-48 AtTic20-IV, TIC20-IV translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
AT2G47840 52 / 6e-08 AtTic20-II translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010636 516 / 0 AT1G04940 338 / 9e-118 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Lus10039783 154 / 3e-45 AT4G03320 263 / 1e-87 translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G231400 358 / 1e-125 AT1G04940 360 / 2e-126 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Potri.002G031800 357 / 2e-125 AT1G04940 363 / 1e-127 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Potri.019G108800 169 / 3e-51 AT4G03320 283 / 2e-95 translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
Potri.013G084900 42 / 0.0001 AT2G47840 196 / 2e-63 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09685 DUF4870 Domain of unknown function (DUF4870)
Representative CDS sequence
>Lus10033195 pacid=23178060 polypeptide=Lus10033195 locus=Lus10033195.g ID=Lus10033195.BGIv1.0 annot-version=v1.0
ATGATTATAAACGGATGCACGTTACCTTCCGGGTATGGAATTATGAATTTCAGAGCAAGTCAATTCCCTCATGGTAGATTGGTTTCTGCTCGCATTCCTT
CTAGCCTATCACCATTAACTATTAGGAGTTCTTGGCAGGAGCCCAAATCTTGTTTCTCGATACCGGCATGTGGGTCTTTCCATAACCTCGCTGCTGTATC
TGAACGAGGTGAATTACTACACATGATTCCATATCTACCAAGAAAGCGTGGATCTTATCTCCCTGCTCGGGCGTCCAAGGATGTCCCTTACAGTTTTCGG
TTCCCTCCAATGACAAAGAAGCCAAGGTGGTGGTGGAGGACGCTAGCATGCCTCCCTTATTTGATGCCTTTCCATGAAACCTGGATGTATGCTCAGACAG
CATATAACTTGCACCCATTCCTTGAACAGTTTGAGTATCTTACATACCCGTTCCTCAGAGCTATTGGTAGCTTGCCAGGCTGGTTCTTGATGGCCTATTT
CTTCTGCGCCTATCTTGGAGTTGTCAGGAGAAAGGAATGGCCTCATTTCTTCAGATTTCATGTGGTGACCGGCATGTTGCTCGAGATTGCCCTGCAGGTG
ATTGGAACGGTGAGTCGTTGGATGCCACAAGGCTTATACTGGGGGAAGCTCGGGATGCACTTTTGGACGGCCCTGGCGTTTGCTCACCTTTTCACTGTCC
TGGAATGCATAAGGTGTGCTATCTGTGGTATGTATGCTGATGTCCCTTTTGTCTCTGATGCTGCATACATTCAGATTCCATATGACTAA
AA sequence
>Lus10033195 pacid=23178060 polypeptide=Lus10033195 locus=Lus10033195.g ID=Lus10033195.BGIv1.0 annot-version=v1.0
MIINGCTLPSGYGIMNFRASQFPHGRLVSARIPSSLSPLTIRSSWQEPKSCFSIPACGSFHNLAAVSERGELLHMIPYLPRKRGSYLPARASKDVPYSFR
FPPMTKKPRWWWRTLACLPYLMPFHETWMYAQTAYNLHPFLEQFEYLTYPFLRAIGSLPGWFLMAYFFCAYLGVVRRKEWPHFFRFHVVTGMLLEIALQV
IGTVSRWMPQGLYWGKLGMHFWTALAFAHLFTVLECIRCAICGMYADVPFVSDAAYIQIPYD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G04940 AtTic20-I, atTI... translocon at the inner envelo... Lus10033195 0 1
AT1G04940 AtTic20-I, atTI... translocon at the inner envelo... Lus10010636 3.5 0.9269
AT5G54600 Translation protein SH3-like f... Lus10038125 8.7 0.9299
AT1G47720 OSB1 Organellar Single-stranded, Pr... Lus10024852 9.3 0.8821
AT4G38160 PDE191 pigment defective 191, Mitocho... Lus10026571 13.7 0.9205
AT2G22870 EMB2001 embryo defective 2001, P-loop ... Lus10039653 13.9 0.8795
AT3G15190 chloroplast 30S ribosomal prot... Lus10041925 16.1 0.9117
AT3G12110 ACT11 actin-11 (.1) Lus10001693 19.0 0.9035
AT2G22360 DNAJ heat shock family protein... Lus10035920 19.1 0.8191
AT5G14910 Heavy metal transport/detoxifi... Lus10032167 21.3 0.9110
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Lus10005719 21.4 0.9167

Lus10033195 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.