Lus10033200 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75350 166 / 7e-54 EMB2184 embryo defective 2184, Ribosomal protein L31 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010639 260 / 3e-91 AT1G75350 169 / 5e-55 embryo defective 2184, Ribosomal protein L31 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G033300 179 / 3e-59 AT1G75350 178 / 2e-58 embryo defective 2184, Ribosomal protein L31 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01197 Ribosomal_L31 Ribosomal protein L31
Representative CDS sequence
>Lus10033200 pacid=23178072 polypeptide=Lus10033200 locus=Lus10033200.g ID=Lus10033200.BGIv1.0 annot-version=v1.0
ATGGCGCAAACTCTGACTAGCGCTTTCCTCCAATTCAAACCGCTCTCTACTCTGCCTCTCTCCGCCTCCAAGCCGATGGTTTGCGCCACAAGAACTAGGA
AAGGAGGGTTTCAGGTGACGTGCAGGAAGAAGGACATACACCCGGAGTTCCACATGGATTCCAAGGTTTACTGCAACGGGGAGCTGGTGATGACCACCGG
CGGCACTCAGAAGGAGTACAACATCGATGTTTGGTCCGGCAACCACCCTTTCTACTTGGGAAACCGCACCGGCGTGCTAGTGGCCGCCGACCAGGTCGAG
AAGTTCCGTAAGAAGTACGGCGAGCTCACCGATTTCATGCAGATTCCTGTCCTCAAAGGCGAGATTGTATTGCCTTCCAGGAAGAAATCTGTCAAGAAGA
AGAAGTAG
AA sequence
>Lus10033200 pacid=23178072 polypeptide=Lus10033200 locus=Lus10033200.g ID=Lus10033200.BGIv1.0 annot-version=v1.0
MAQTLTSAFLQFKPLSTLPLSASKPMVCATRTRKGGFQVTCRKKDIHPEFHMDSKVYCNGELVMTTGGTQKEYNIDVWSGNHPFYLGNRTGVLVAADQVE
KFRKKYGELTDFMQIPVLKGEIVLPSRKKSVKKKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G75350 EMB2184 embryo defective 2184, Ribosom... Lus10033200 0 1
AT1G75350 EMB2184 embryo defective 2184, Ribosom... Lus10010639 1.4 0.9886
AT5G65220 Ribosomal L29 family protein ... Lus10019653 1.7 0.9809
AT2G33450 Ribosomal L28 family (.1) Lus10011792 2.8 0.9750
AT1G79850 PDE347, CS17, P... PLASTID RIBOSOMAL SMALL SUBUNI... Lus10025799 3.2 0.9777
AT4G34620 SSR16 small subunit ribosomal protei... Lus10027058 3.2 0.9832
AT5G65220 Ribosomal L29 family protein ... Lus10000745 3.5 0.9790
AT5G14320 EMB3137 EMBRYO DEFECTIVE 3137, Ribosom... Lus10025642 5.3 0.9762
AT5G30510 ARRPS1, RPS1 ribosomal protein S1 (.1) Lus10037822 5.5 0.9769
AT4G34620 SSR16 small subunit ribosomal protei... Lus10025592 6.3 0.9734
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Lus10027894 6.6 0.9729

Lus10033200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.