Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G59171 81 / 4e-22 Inositol-pentakisphosphate 2-kinase family protein (.1.2) AT5G42810 57 / 4e-11 ATIPK1 inositol-pentakisphosphate 2-kinase 1 (.1) AT1G22100 52 / 1e-09 Inositol-pentakisphosphate 2-kinase family protein (.1) AT1G58643 49 / 2e-08 Inositol-pentakisphosphate 2-kinase family protein (.1) AT1G59312 49 / 2e-08 Inositol-pentakisphosphate 2-kinase family protein (.1) AT1G58936 49 / 2e-08 Inositol-pentakisphosphate 2-kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010640 [exp] 81 / 2e-19 AT1G22100 491 / 3e-172 Inositol-pentakisphosphate 2-kinase family protein (.1) Lus10024274 [exp] 60 / 3e-12 AT1G22100 521 / 0.0 Inositol-pentakisphosphate 2-kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G230200 [exp] 60 / 3e-12 AT5G42810 508 / 1e-178 inositol-pentakisphosphate 2-kinase 1 (.1) Potri.002G032900 [exp] 59 / 9e-12 AT5G42810 494 / 2e-173 inositol-pentakisphosphate 2-kinase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033202 pacid=23178095 polypeptide=Lus10033202 locus=Lus10033202.g ID=Lus10033202.BGIv1.0 annot-version=v1.0 ATGGAGTCCAAGTTAGATGCGAAAGATGCTGAGAATTGGGTTTACAGAGGGGAAGGAGCAGCTAATCTCGTTCTCTCCTACTCTGGATCATCCCCTGCTT TTGTGAATTTCATTGACTTGGATTTGAAACGTTTAAAGAAGATAGAGGACTACTATGAACTGGACCAGAAGATAGTGAAGTGCTATAATCAGACGAAACT TAATCCTGCGAGCTCATAG
AA sequence Show only first row Show all	>Lus10033202 pacid=23178095 polypeptide=Lus10033202 locus=Lus10033202.g ID=Lus10033202.BGIv1.0 annot-version=v1.0 MESKLDAKDAENWVYRGEGAANLVLSYSGSSPAFVNFIDLDLKRLKKIEDYYELDQKIVKCYNQTKLNPASS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G59171			Inositol-pentakisphosphate 2-k...		Lus10033202 [exp]	0	1
AT4G15550		IAGLU	indole-3-acetate beta-D-glucos...		Lus10019989 [exp]	7.9	0.9025
AT1G67940		ABCI17, AtSTAR1...	ARABIDOPSIS THALIANA NON-INTRI...		Lus10031069 [exp]	10.1	0.9117
AT1G51340			MATE efflux family protein (.1...		Lus10042365 [exp]	12.3	0.8928
AT5G28540		BIP1	heat shock protein 70 (Hsp 70)...		Lus10007777 [exp]	18.6	0.8800
AT3G22470			Pentatricopeptide repeat (PPR)...		Lus10039310 [exp]	20.4	0.8286
AT3G13050		AtNiaP	nicotinate transporter, Major ...		Lus10033336 [exp]	22.8	0.8769
AT4G21380		ARK3	receptor kinase 3 (.1)		Lus10033365 [exp]	29.0	0.8985
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10032220 [exp]	35.3	0.8826
AT2G46960		CYP709B1	"cytochrome P450, family 709, ...		Lus10034134 [exp]	40.5	0.8848
AT3G11340		UGT76B1	UDP-dependent glycosyltransfer...		Lus10016461 [exp]	41.5	0.8857

Compare expression of checked genes

Lus10033202 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.