Lus10033211 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10033211 pacid=23178043 polypeptide=Lus10033211 locus=Lus10033211.g ID=Lus10033211.BGIv1.0 annot-version=v1.0
ATGCCTGGCCGTCGTTCAATTTTCATTGCAGCAACCGTGTGCGCAAGAAGAGTTGAGTCCCCAACTTGGTTGCAACTTGCAACAGGAGATCCCTATTTAT
CTATGGCAGATCCTTGGTTTGGCTCTTCCAATCTCATAAACTGCCTTCTCCCCTTTAGGAAAGGTTCTCAGTTGCCAAATTTGAGATTGGCAAGTAGTTC
AACTCCTATTTCAGGGTCGAAATGGCTGAAGAGTGATGACGCCGTCCCTACTGAAGCCCACAGAGGTCTACAAAAAAGGGAAGGCCCATCGTCAAATCGG
ATCATGAAGGATGTTCCTCTGGAACTTTCGGAGCTGTTGGAGAGAAGCGGAGTGTGA
AA sequence
>Lus10033211 pacid=23178043 polypeptide=Lus10033211 locus=Lus10033211.g ID=Lus10033211.BGIv1.0 annot-version=v1.0
MPGRRSIFIAATVCARRVESPTWLQLATGDPYLSMADPWFGSSNLINCLLPFRKGSQLPNLRLASSSTPISGSKWLKSDDAVPTEAHRGLQKREGPSSNR
IMKDVPLELSELLERSGV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10033211 0 1
Lus10016821 2.8 0.8652
Lus10038080 6.6 0.8673
AT1G54860 Glycoprotein membrane precurso... Lus10004470 8.7 0.8469
AT2G34790 MEE23, EDA28 MATERNAL EFFECT EMBRYO ARREST ... Lus10033516 9.8 0.8326
AT5G04885 Glycosyl hydrolase family prot... Lus10019385 12.0 0.8552
Lus10036407 16.1 0.7852
AT4G21120 CAT1, AAT1 CATIONIC AMINO ACID TRANSPORTE... Lus10003697 16.7 0.8483
AT3G29000 Calcium-binding EF-hand family... Lus10019090 17.5 0.8210
Lus10027005 17.8 0.8459
AT2G14560 LURP1 LATE UPREGULATED IN RESPONSE T... Lus10009095 18.0 0.8222

Lus10033211 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.