Lus10033219 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42000 271 / 7e-95 ORMDL family protein (.1.2)
AT1G01230 252 / 3e-87 ORMDL family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023031 319 / 5e-114 AT5G42000 270 / 1e-94 ORMDL family protein (.1.2)
Lus10005980 257 / 2e-89 AT1G01230 295 / 1e-104 ORMDL family protein (.1)
Lus10030232 243 / 1e-76 AT1G09880 661 / 0.0 Rhamnogalacturonate lyase family protein (.1)
Lus10003209 214 / 5e-73 AT5G42000 194 / 2e-65 ORMDL family protein (.1.2)
Lus10017314 212 / 1e-71 AT5G42000 197 / 3e-66 ORMDL family protein (.1.2)
Lus10031614 83 / 2e-21 AT2G40190 81 / 1e-20 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G144600 283 / 7e-100 AT5G42000 281 / 8e-99 ORMDL family protein (.1.2)
Potri.001G086300 277 / 2e-97 AT5G42000 273 / 1e-95 ORMDL family protein (.1.2)
Potri.002G174400 259 / 3e-90 AT1G01230 254 / 3e-88 ORMDL family protein (.1)
Potri.014G101000 258 / 1e-89 AT1G01230 285 / 3e-100 ORMDL family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04061 ORMDL ORMDL family
Representative CDS sequence
>Lus10033219 pacid=23172084 polypeptide=Lus10033219 locus=Lus10033219.g ID=Lus10033219.BGIv1.0 annot-version=v1.0
ATGTACGTGAGAGCAGATCCTTCGACGGATGTGAATCGGAACACCGAATGGTTCACCTATCCAGGCGTCTGGACTACTTACATCGGCATCCTTTTCGCCT
CCTGGTTCATGGTTATCTGCCTCCTGGGCTGCTCCCCCGGCACCGCTTGGACCGTCGTCCATCTCGCCCACTTCCTAATTACGTACCACTTCTTTCACTG
GAAGAAGGGAACTCCATTTGCTGACGACCAAGGTATCTACAATGGGTTGACATGGTGGGAACAAATAGAGAACGGCAAGCAGCTAACACGTAATAGGAAG
TTTCTCACTATTGTTCCAGTTGTGCTATATCTGATAGCCTCACACACCACAAACTACCAAAATCCAATGTTGTTCTTCAACACAATGGCCGTATTCGTGC
TGGTAGTCGCAAAGTTCCCTCACATGCACAAAGTCCGGATTTTTGGTATCAATGCCGACTTCTGA
AA sequence
>Lus10033219 pacid=23172084 polypeptide=Lus10033219 locus=Lus10033219.g ID=Lus10033219.BGIv1.0 annot-version=v1.0
MYVRADPSTDVNRNTEWFTYPGVWTTYIGILFASWFMVICLLGCSPGTAWTVVHLAHFLITYHFFHWKKGTPFADDQGIYNGLTWWEQIENGKQLTRNRK
FLTIVPVVLYLIASHTTNYQNPMLFFNTMAVFVLVVAKFPHMHKVRIFGINADF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42000 ORMDL family protein (.1.2) Lus10033219 0 1
Lus10003603 1.7 0.9260
AT1G31870 unknown protein Lus10033140 4.2 0.9006
AT2G06210 VIP6, ELF8 VERNALIZATION INDEPENDENCE 6, ... Lus10000472 5.0 0.8939
AT1G66240 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.... Lus10008963 7.5 0.8868
AT1G32420 F-box and associated interacti... Lus10016866 11.8 0.8728
AT1G20510 OPCL1 OPC-8:0 CoA ligase1 (.1.2) Lus10022336 15.8 0.8693
AT5G57710 Double Clp-N motif-containing ... Lus10023201 22.9 0.8359
AT3G58680 MBF1B, ATMBF1B multiprotein bridging factor 1... Lus10013686 26.8 0.8729
AT1G72390 unknown protein Lus10013170 28.1 0.8961
AT5G12840 CCAAT NF-YA1, ATHAP2A... "nuclear factor Y, subunit A1"... Lus10009944 30.6 0.8792

Lus10033219 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.