Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27745 194 / 6e-66 Yippee family putative zinc-binding protein (.1) AT3G08990 117 / 3e-35 Yippee family putative zinc-binding protein (.1.2) AT3G11230 115 / 2e-34 Yippee family putative zinc-binding protein (.1.2) AT5G53940 113 / 2e-33 Yippee family putative zinc-binding protein (.1) AT2G40110 113 / 2e-33 Yippee family putative zinc-binding protein (.1.2) AT4G27740 111 / 6e-33 Yippee family putative zinc-binding protein (.1) AT3G55890 110 / 3e-32 Yippee family putative zinc-binding protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000335 [exp] 221 / 2e-76 AT4G27745 195 / 2e-66 Yippee family putative zinc-binding protein (.1) Lus10007773 [exp] 192 / 3e-65 AT4G27745 186 / 7e-63 Yippee family putative zinc-binding protein (.1) Lus10028300 [exp] 120 / 2e-36 AT2G40110 228 / 8e-79 Yippee family putative zinc-binding protein (.1.2) Lus10040190 [exp] 119 / 6e-36 AT2G40110 228 / 1e-78 Yippee family putative zinc-binding protein (.1.2) Lus10023244 [exp] 117 / 2e-35 AT4G27740 124 / 2e-38 Yippee family putative zinc-binding protein (.1) Lus10035531 [exp] 110 / 2e-32 AT3G08990 174 / 2e-57 Yippee family putative zinc-binding protein (.1.2) Lus10027762 [exp] 109 / 5e-32 AT2G40110 173 / 4e-57 Yippee family putative zinc-binding protein (.1.2) Lus10013992 [exp] 107 / 5e-31 AT5G53940 157 / 1e-50 Yippee family putative zinc-binding protein (.1) Lus10015416 [exp] 107 / 5e-31 AT5G53940 169 / 1e-55 Yippee family putative zinc-binding protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G085400 [exp] 206 / 2e-70 AT4G27745 197 / 3e-67 Yippee family putative zinc-binding protein (.1) Potri.012G019100 [exp] 198 / 1e-67 AT4G27745 202 / 2e-69 Yippee family putative zinc-binding protein (.1) Potri.015G009200 [exp] 194 / 4e-66 AT4G27745 201 / 1e-68 Yippee family putative zinc-binding protein (.1) Potri.003G145400 [exp] 187 / 3e-63 AT4G27745 179 / 3e-60 Yippee family putative zinc-binding protein (.1) Potri.014G101600 [exp] 158 / 2e-51 AT4G27745 154 / 2e-50 Yippee family putative zinc-binding protein (.1) Potri.010G190000 [exp] 126 / 1e-38 AT2G40110 224 / 6e-77 Yippee family putative zinc-binding protein (.1.2) Potri.015G009100 [exp] 123 / 1e-37 AT4G27740 131 / 4e-41 Yippee family putative zinc-binding protein (.1) Potri.012G019200 [exp] 122 / 1e-37 AT4G27740 131 / 4e-41 Yippee family putative zinc-binding protein (.1) Potri.006G015500 [exp] 121 / 1e-36 AT3G08990 122 / 6e-37 Yippee family putative zinc-binding protein (.1.2) Potri.008G067100 [exp] 120 / 5e-36 AT2G40110 232 / 1e-79 Yippee family putative zinc-binding protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0080 [flax] [poplar] Beta-tent PF03226 [flax] [poplar] Yippee-Mis18 Yippee zinc-binding/DNA-binding /Mis18, centromere assembly
Representative CDS sequence Show only first row Show all	>Lus10033226 pacid=23172177 polypeptide=Lus10033226 locus=Lus10033226.g ID=Lus10033226.BGIv1.0 annot-version=v1.0 ATGGCGTTTCCTTTTGATTTCGCAGGGAAAGAAATGGCAGAAGTAATTGGACCAAGGTTGTACAGTTGCTGTAATTGCAGAAACCATGTTGGCCTTCATG ATGATGTGATTTCCAAGGCTTTTCAGGGACGACAAGGTAGAGCGTTTCTGTTCTCTCATGCGATGAACGTCGCAGTAGGAGAGAAGGAGGATAGGAATCT GGCGACTGGCCTCCACACAGTCGCTGACGTGTACTGCAGTGACTGCCGAGAGGTGCTTGGCTGGAAGTATGAGCGAGCTTATCAAGAGTCTCAGAAGTAC AAGGAAGGCAAGTTCATTCTCGAGAAGTCGAAAATTGTCAAGGAGAACTGGTAG
AA sequence Show only first row Show all	>Lus10033226 pacid=23172177 polypeptide=Lus10033226 locus=Lus10033226.g ID=Lus10033226.BGIv1.0 annot-version=v1.0 MAFPFDFAGKEMAEVIGPRLYSCCNCRNHVGLHDDVISKAFQGRQGRAFLFSHAMNVAVGEKEDRNLATGLHTVADVYCSDCREVLGWKYERAYQESQKY KEGKFILEKSKIVKENW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27745			Yippee family putative zinc-bi...		Lus10033226 [exp]	0	1
AT4G27745			Yippee family putative zinc-bi...		Lus10000335 [exp]	2.0	0.9051
AT1G04280			P-loop containing nucleoside t...		Lus10021226 [exp]	3.0	0.8915
AT5G47060			Protein of unknown function (D...		Lus10043343 [exp]	6.0	0.8924
AT1G22450		ATCOX6B2, COX6B	CYTOCHROME C OXIDASE 6B2, cyto...		Lus10010345 [exp]	7.7	0.8508
AT5G09430			alpha/beta-Hydrolases superfam...		Lus10033451 [exp]	10.4	0.8894
AT2G38900			Serine protease inhibitor, pot...		Lus10003225 [exp]	13.3	0.8565
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10022883 [exp]	13.7	0.8810
AT3G49870		ATARLA1C	ADP-ribosylation factor-like A...		Lus10019259 [exp]	14.1	0.8705
					Lus10007012 [exp]	15.2	0.8697
AT3G10850		GLY2, GLX2-2	GLYOXALASE 2-2, Metallo-hydrol...		Lus10029086 [exp]	15.7	0.8609

Compare expression of checked genes

Lus10033226 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.