Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033246 pacid=23172255 polypeptide=Lus10033246 locus=Lus10033246.g ID=Lus10033246.BGIv1.0 annot-version=v1.0 ATGAAGGGCCCTTGTTGCACTGTCGTCGCTTCGATGATTGCTGCCTCCACAGTGGCCTTCTCCTCCTCCTCGTCGACCACCGCCGCTGAGCGTGGCGTGG CCTCCCAGATCATTGAAAATAAATTGTTGATCACTGAAGGAGAATCAGATGATGTAACAGACATAACGCCCCCATTATGA
AA sequence Show only first row Show all	>Lus10033246 pacid=23172255 polypeptide=Lus10033246 locus=Lus10033246.g ID=Lus10033246.BGIv1.0 annot-version=v1.0 MKGPCCTVVASMIAASTVAFSSSSSTTAAERGVASQIIENKLLITEGESDDVTDITPPL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10033246 [exp]	0	1
AT4G35790		ATPLDDELTA	ARABIDOPSIS THALIANA PHOSPHOLI...		Lus10004156 [exp]	8.8	0.6675
AT3G06260		GolS9, GATL4	galactinol synthase 9, galactu...		Lus10012765 [exp]	10.1	0.7142
AT5G42570			B-cell receptor-associated 31-...		Lus10030043 [exp]	15.7	0.7333
AT4G08170			Inositol 1,3,4-trisphosphate 5...		Lus10032808 [exp]	19.8	0.7014
AT4G08170			Inositol 1,3,4-trisphosphate 5...		Lus10007689 [exp]	21.7	0.6030
AT1G02816			Protein of unknown function, D...		Lus10009855 [exp]	27.7	0.6400
AT4G00950		MEE47	maternal effect embryo arrest ...		Lus10030238 [exp]	42.9	0.6351
AT1G19210	AP2_ERF		Integrase-type DNA-binding sup...		Lus10009798 [exp]	46.0	0.6621
AT5G67150			HXXXD-type acyl-transferase fa...		Lus10041591 [exp]	66.3	0.6404
AT1G13120		EMB1745	embryo defective 1745 (.1)		Lus10001317 [exp]	70.0	0.6385

Compare expression of checked genes

Lus10033246 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.