Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18196 252 / 2e-86 Heavy metal transport/detoxification superfamily protein (.1) AT4G10465 224 / 2e-75 Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 105 / 4e-29 Heavy metal transport/detoxification superfamily protein (.1) AT3G56891 103 / 4e-28 Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 88 / 2e-22 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT1G71050 88 / 3e-22 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 85 / 6e-21 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 79 / 8e-19 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT4G08570 79 / 9e-19 Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 79 / 1e-18 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008284 [exp] 377 / 8e-136 AT2G18196 246 / 4e-84 Heavy metal transport/detoxification superfamily protein (.1) Lus10010147 [exp] 176 / 6e-56 AT2G18196 165 / 5e-52 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 100 / 1e-26 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 99 / 1e-26 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 96 / 5e-25 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10009115 [exp] 92 / 1e-23 AT5G17450 206 / 5e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10028531 [exp] 91 / 2e-23 AT5G17450 207 / 1e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10020704 [exp] 91 / 4e-23 AT1G06330 173 / 3e-56 Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 89 / 2e-22 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G452400 [exp] 275 / 1e-95 AT2G18196 256 / 3e-88 Heavy metal transport/detoxification superfamily protein (.1) Potri.011G149500 [exp] 269 / 2e-93 AT2G18196 257 / 9e-89 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G024800 [exp] 134 / 2e-40 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1) Potri.011G065600 [exp] 121 / 3e-35 AT1G06330 159 / 7e-51 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G106500 [exp] 104 / 1e-28 AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G107500 [exp] 99 / 1e-26 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 98 / 4e-26 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.017G123400 [exp] 95 / 4e-25 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.010G114600 [exp] 94 / 2e-24 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 93 / 3e-24 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10033250 pacid=23172089 polypeptide=Lus10033250 locus=Lus10033250.g ID=Lus10033250.BGIv1.0 annot-version=v1.0 ATGGGGTCAAATGTGTTGGCCACAGCATTCAAGTCGATAATATCTGCAATTAGCTACTGTTACTTTCACTTTGGTGAAGAGCACGGCCTTCACTCCATCT CTGCCCCCATCAACCGCAGCATGAAACACAAGGGCTCCGACAAGACCAAGTCTCGCCCACTCTCCTTGCAGACAGTGGAGCTTAAAGTAAGGATGTGCTG TAGCGGGTGCGAGAGAGTGGTGAAGAGGGCCATTTATAAGCTTAGAGGAGTGGATTCGGTGGAGGTAGAGGTGGCGATGGAGAAAGTGACGGTGGTAGGG TACGTAGAAAGGAACAAGGTGCTCAAGGCAATTCGGAGGTCCGGCAAAAGAGCTGAGTTTTGGCCGTACCCAAATCCACCGCTCTACTTCACTTCATCCA ACCATTACTTCAAGGACACAACCGCCGAGTTTAAGGACAGCTACAACTACTACCGCCACGGCTACAACCTCCCCGACCGCCACGGCAACGTCCCCGTCAC CCCCCGCGGCGACGACAAGGTCAGCAACATGTTCAACGACGACAACGTCAACGCCACCTGCTCCCTCATGTGA
AA sequence Show only first row Show all	>Lus10033250 pacid=23172089 polypeptide=Lus10033250 locus=Lus10033250.g ID=Lus10033250.BGIv1.0 annot-version=v1.0 MGSNVLATAFKSIISAISYCYFHFGEEHGLHSISAPINRSMKHKGSDKTKSRPLSLQTVELKVRMCCSGCERVVKRAIYKLRGVDSVEVEVAMEKVTVVG YVERNKVLKAIRRSGKRAEFWPYPNPPLYFTSSNHYFKDTTAEFKDSYNYYRHGYNLPDRHGNVPVTPRGDDKVSNMFNDDNVNATCSLM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G18196			Heavy metal transport/detoxifi...		Lus10033250 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Lus10033953 [exp]	3.2	0.9364
AT3G08510		ATPLC2	phospholipase C 2 (.1.2.3)		Lus10036182 [exp]	5.2	0.8902
AT1G67790			unknown protein		Lus10034566 [exp]	5.7	0.9243
AT5G36930			Disease resistance protein (TI...		Lus10007813 [exp]	6.3	0.9009
AT3G22400		ATLOX5, LOX5	Arabidopsis thaliana lipoxygen...		Lus10025857 [exp]	6.5	0.9082
AT1G68740		PHO1;H1	EXS (ERD1/XPR1/SYG1) family pr...		Lus10019155 [exp]	6.5	0.8642
AT5G02920			F-box/RNI-like superfamily pro...		Lus10037289 [exp]	7.3	0.8214
AT3G55370	DOF	OBP3, AtDof3. 6	OBF-binding protein 3 (.1.2.3)		Lus10005956 [exp]	9.8	0.8927
AT5G15080			Protein kinase superfamily pro...		Lus10038087 [exp]	10.0	0.8877
AT5G11100		SYT4, NTMCTYPE2...	synaptotagmin 4, Calcium-depen...		Lus10006193 [exp]	11.0	0.8087

Compare expression of checked genes

Lus10033250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.