Lus10033270 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45275 178 / 4e-54 Major facilitator superfamily protein (.1)
AT1G31470 159 / 5e-47 NFD4 NUCLEAR FUSION DEFECTIVE 4, Major facilitator superfamily protein (.1)
AT4G19450 155 / 1e-45 Major facilitator superfamily protein (.1)
AT3G01630 147 / 9e-43 Major facilitator superfamily protein (.1)
AT2G30300 82 / 4e-19 Major facilitator superfamily protein (.1)
AT2G16660 66 / 1e-13 Major facilitator superfamily protein (.1)
AT4G34950 66 / 2e-13 Major facilitator superfamily protein (.1)
AT3G01930 57 / 2e-10 Major facilitator superfamily protein (.1.2)
AT5G14120 57 / 2e-10 Major facilitator superfamily protein (.1)
AT1G74780 57 / 4e-10 Nodulin-like / Major Facilitator Superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034738 200 / 1e-62 AT4G19450 691 / 0.0 Major facilitator superfamily protein (.1)
Lus10033280 119 / 4e-35 AT5G45275 72 / 3e-15 Major facilitator superfamily protein (.1)
Lus10042234 97 / 1e-26 AT2G30300 116 / 3e-31 Major facilitator superfamily protein (.1)
Lus10015470 102 / 4e-26 AT2G30300 351 / 2e-115 Major facilitator superfamily protein (.1)
Lus10026422 96 / 5e-24 AT2G30300 379 / 5e-126 Major facilitator superfamily protein (.1)
Lus10015469 96 / 6e-24 AT2G30300 396 / 5e-133 Major facilitator superfamily protein (.1)
Lus10019941 92 / 1e-22 AT2G30300 307 / 1e-98 Major facilitator superfamily protein (.1)
Lus10025053 71 / 3e-15 AT4G34950 793 / 0.0 Major facilitator superfamily protein (.1)
Lus10034491 70 / 1e-14 AT4G34950 788 / 0.0 Major facilitator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G128200 194 / 4e-60 AT4G19450 774 / 0.0 Major facilitator superfamily protein (.1)
Potri.003G105600 190 / 1e-58 AT4G19450 734 / 0.0 Major facilitator superfamily protein (.1)
Potri.019G126700 89 / 1e-21 AT2G30300 427 / 4e-145 Major facilitator superfamily protein (.1)
Potri.013G084000 89 / 2e-21 AT2G30300 241 / 2e-73 Major facilitator superfamily protein (.1)
Potri.013G154000 85 / 5e-20 AT2G30300 380 / 4e-127 Major facilitator superfamily protein (.1)
Potri.009G132700 71 / 4e-15 AT4G34950 661 / 0.0 Major facilitator superfamily protein (.1)
Potri.004G173400 71 / 5e-15 AT4G34950 682 / 0.0 Major facilitator superfamily protein (.1)
Potri.003G012300 64 / 1e-12 AT1G80530 650 / 0.0 Major facilitator superfamily protein (.1)
Potri.006G060900 63 / 3e-12 AT1G80530 632 / 0.0 Major facilitator superfamily protein (.1)
Potri.005G112400 61 / 7e-12 AT4G34950 618 / 0.0 Major facilitator superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10033270 pacid=23172112 polypeptide=Lus10033270 locus=Lus10033270.g ID=Lus10033270.BGIv1.0 annot-version=v1.0
ATGGCACTGTACATAGCAAGTGGCATGGTCGGACTCAGCTCGGGGTTCATTTTTGCAGCAGCAGTGTCTATAACCTCGGAGCTGTTCGGTCCCAACAGTG
TGAGTGTGAACCATAACATTCTCATCACCAACATCCCGGTAGGATCGCTCATTTACGGGTTCCTGGCGGCCATAGTGTACGATGCTAATGCAATGTCCGG
GTCCGGTAAGGGAGGCATTATGAACGTGTTGAACTCGGACTCGATAGTATGCATGGGGAAGGAGTGTTATTTCTTGACGTTTGTGTGGTGGGGGTGTCTG
GCTATTGTCGGGTTGGTTTCTAGTATGCTGCTCTTCTTGAGGACGAGACATGCTTATGATCAGTTTGAACGGAAACGTGCTGTATCATCACAGCTTTATT
AG
AA sequence
>Lus10033270 pacid=23172112 polypeptide=Lus10033270 locus=Lus10033270.g ID=Lus10033270.BGIv1.0 annot-version=v1.0
MALYIASGMVGLSSGFIFAAAVSITSELFGPNSVSVNHNILITNIPVGSLIYGFLAAIVYDANAMSGSGKGGIMNVLNSDSIVCMGKECYFLTFVWWGCL
AIVGLVSSMLLFLRTRHAYDQFERKRAVSSQLY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45275 Major facilitator superfamily ... Lus10033270 0 1
AT1G34000 OHP2 one-helix protein 2 (.1) Lus10017779 6.4 0.7810
AT1G24040 Acyl-CoA N-acyltransferases (N... Lus10030837 7.7 0.7521
AT5G64460 Phosphoglycerate mutase family... Lus10007093 15.7 0.7620
AT2G14110 Haloacid dehalogenase-like hyd... Lus10007071 22.4 0.7241
AT3G02870 VTC4 Inositol monophosphatase famil... Lus10039046 24.0 0.7091
AT1G33810 unknown protein Lus10005296 37.8 0.6092
AT5G60540 EMB2407, ATPDX2... EMBRYO DEFECTIVE 2407, pyridox... Lus10041445 50.5 0.7181
AT2G41150 unknown protein Lus10008860 79.5 0.7024
AT4G14450 ATBET12 unknown protein Lus10022200 90.2 0.6821
AT4G19450 Major facilitator superfamily ... Lus10034738 94.1 0.6776

Lus10033270 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.