Lus10033284 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10033284 pacid=23172217 polypeptide=Lus10033284 locus=Lus10033284.g ID=Lus10033284.BGIv1.0 annot-version=v1.0
ATGAATTACAGAGTGGATATATGTATAACATTCGTCATTCCCTTCATACGTTTGTTACCATTTATGTTTCTGGTTCTGTCAAATGTGCAAGCCTTAGCAA
TTTGCATGGGAGAAAGCCCGGATGACCAGGAGAAGGACATGGCCCAGATTCTTGCTACTGCAACTAAGGACGTGGCGGCACTCCGGATCACCGAGGAGAA
GAAGCGGCGACGTTCGGAGGCACCGGAGGCGGACTTCATGGATACGACCGAACCCACTGATCAAACGCCGTCCAAGTCACCGACGAAGCCGGGACAAGTG
AGGCTGCGAGTGGCATCCACGGAAGTAGCTCGGCAACATGGAGCCCGTTAA
AA sequence
>Lus10033284 pacid=23172217 polypeptide=Lus10033284 locus=Lus10033284.g ID=Lus10033284.BGIv1.0 annot-version=v1.0
MNYRVDICITFVIPFIRLLPFMFLVLSNVQALAICMGESPDDQEKDMAQILATATKDVAALRITEEKKRRRSEAPEADFMDTTEPTDQTPSKSPTKPGQV
RLRVASTEVARQHGAR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10033284 0 1
AT5G45380 ATDUR3 DEGRADATION OF UREA 3, solute:... Lus10033882 1.7 0.9528
AT1G73110 P-loop containing nucleoside t... Lus10024092 2.4 0.9572
Lus10038743 4.7 0.9530
AT4G29035 Plant self-incompatibility pro... Lus10022825 5.9 0.9485
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Lus10026009 6.3 0.9346
AT3G19550 unknown protein Lus10013900 6.5 0.9346
AT5G46090 Protein of unknown function (D... Lus10018635 6.9 0.9479
AT5G64440 ATFAAH fatty acid amide hydrolase (.1... Lus10035974 7.2 0.9500
AT5G51160 Ankyrin repeat family protein ... Lus10029006 8.0 0.8815
AT1G15170 MATE efflux family protein (.1... Lus10029694 8.9 0.9158

Lus10033284 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.