Lus10033298 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034761 250 / 5e-82 AT5G66900 197 / 1e-54 Disease resistance protein (CC-NBS-LRR class) family (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10033298 pacid=23172247 polypeptide=Lus10033298 locus=Lus10033298.g ID=Lus10033298.BGIv1.0 annot-version=v1.0
ATGAGAGCTAAGGAGTCTTTCAGATCTTCAGGTGTTTCCAGTTTCGAGGGGCAAGATTCTTTTGAGAGTCAGCTGGATGAAGAAAATGAAGTCAACAAAT
ACTCCAACGACCAAGGCTCATTTCCACACCTAGCCTCAAATACTGAAGATGCTAGCCTTTCTGGCGAGAAGAGCGAATCGCACAAGTCAGATGACGATGA
TGACCCTTGTCAGGTTTCAGTTGGTCTTCCAAACACTGGCAGTGACAGTAGTAAAGATGACATCTTCGGTGATAAGCAGTTTATTGTGCAACAAGATATT
GTAGAGGCTTTAGCCATTCTTCAAAACAACACAGGAAGCATTGATCAAGGAAACGACTTGGTGATGAAAGTCGGAGGAACAAATTACCCAAGTTCTGAAA
TTATGCCAATTGCGATGCAAAGTTAA
AA sequence
>Lus10033298 pacid=23172247 polypeptide=Lus10033298 locus=Lus10033298.g ID=Lus10033298.BGIv1.0 annot-version=v1.0
MRAKESFRSSGVSSFEGQDSFESQLDEENEVNKYSNDQGSFPHLASNTEDASLSGEKSESHKSDDDDDPCQVSVGLPNTGSDSSKDDIFGDKQFIVQQDI
VEALAILQNNTGSIDQGNDLVMKVGGTNYPSSEIMPIAMQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10033298 0 1
AT5G66900 Disease resistance protein (CC... Lus10033299 1.4 0.8831
AT2G39435 Phosphatidylinositol N-acetygl... Lus10030320 1.7 0.9009
AT4G01710 ARPC5, CRK CROOKED, ARP2/3 complex 16 kDa... Lus10012040 4.6 0.8822
AT4G12020 WRKY MEKK4, MAPKKK11... MAPK/ERK KINASE KINASE 4, MITO... Lus10016282 5.1 0.8672
Lus10043073 8.8 0.8422
AT2G32760 unknown protein Lus10037826 10.5 0.8697
AT5G17460 unknown protein Lus10009117 10.6 0.8523
AT3G18215 Protein of unknown function, D... Lus10009640 10.7 0.8748
AT2G19260 RING/FYVE/PHD zinc finger supe... Lus10020162 11.8 0.8810
AT1G03670 ankyrin repeat family protein ... Lus10020209 13.1 0.8410

Lus10033298 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.