Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66910 42 / 3e-05 Disease resistance protein (CC-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034761 [exp] 191 / 8e-60 AT5G66900 197 / 1e-54 Disease resistance protein (CC-NBS-LRR class) family (.1) Lus10022464 [exp] 83 / 2e-19 AT5G66900 531 / 2e-177 Disease resistance protein (CC-NBS-LRR class) family (.1) Lus10020779 [exp] 50 / 3e-08 AT5G66900 434 / 5e-141 Disease resistance protein (CC-NBS-LRR class) family (.1) Lus10007359 [exp] 46 / 1e-06 AT5G66900 473 / 3e-154 Disease resistance protein (CC-NBS-LRR class) family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G039100 [exp] 102 / 1e-26 AT5G66900 474 / 3e-156 Disease resistance protein (CC-NBS-LRR class) family (.1) Potri.007G039000 [exp] 102 / 2e-26 AT5G66900 343 / 2e-107 Disease resistance protein (CC-NBS-LRR class) family (.1) Potri.014G035700 [exp] 43 / 1e-05 AT4G33300 889 / 0.0 ADR1-like 1 (.1.2) Potri.007G038800 [exp] 41 / 1e-05 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05659 [flax] [poplar] RPW8 Arabidopsis broad-spectrum mildew resistance protein RPW8
Representative CDS sequence Show only first row Show all	>Lus10033300 pacid=23172134 polypeptide=Lus10033300 locus=Lus10033300.g ID=Lus10033300.BGIv1.0 annot-version=v1.0 ATGGCTGCTTCTTTTATAGCTTCAGCTGCTACTGGAGCTGGTCTGGAGTTAGTTTTCGGAACTTTCCTCAGAGTAGTTTTCGAGGTAAAGAAGACCAACT CCCAATTCGCCCCAAGCCTAAAACTCCTCGAAGCTACCGTCAACGATTTGACTCCAGATATCAAGAGAATCGATGCATTCAACAGAGATTTCGATCGTCC GGATGAGATGGCCGATCTAAAGGAGTTGACGACCGAAGGGGAACTGTTGGTTCGTAAGTGCTTGAAGATCCATCGCTACAACATATTCAAGAGGTACAGC TATGCCAAGAAGCTTCTGAGGTTGAACCGTTCCATCCCTTAG
AA sequence Show only first row Show all	>Lus10033300 pacid=23172134 polypeptide=Lus10033300 locus=Lus10033300.g ID=Lus10033300.BGIv1.0 annot-version=v1.0 MAASFIASAATGAGLELVFGTFLRVVFEVKKTNSQFAPSLKLLEATVNDLTPDIKRIDAFNRDFDRPDEMADLKELTTEGELLVRKCLKIHRYNIFKRYS YAKKLLRLNRSIP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66630		DAR5	DA1-related protein 5 (.1)		Lus10033300 [exp]	0	1
AT1G76390		PUB43	plant U-box 43, ARM repeat sup...		Lus10005988 [exp]	4.5	0.8175
AT4G32850		PAP(IV), PAP(IV...	poly\(A\) polymerase IV, poly\...		Lus10006029 [exp]	5.9	0.8424
AT5G45190			Cyclin family protein (.1.2)		Lus10041213 [exp]	16.6	0.8085
AT5G28850			Calcium-binding EF-hand family...		Lus10011811 [exp]	17.2	0.8020
AT3G27870			ATPase E1-E2 type family prote...		Lus10008776 [exp]	24.0	0.7298
AT5G65290			LMBR1-like membrane protein (....		Lus10025735 [exp]	24.8	0.7969
AT4G24970			Histidine kinase-, DNA gyrase ...		Lus10022438 [exp]	26.5	0.7925
AT2G13680		GLS2, ATGSL02, ...	ARABIDOPSIS THALIANA GLUCAN SY...		Lus10002096 [exp]	30.6	0.7648
AT4G02020		SDG10, SWINGER,...	SWINGER, SET DOMAIN-CONTAINING...		Lus10041386 [exp]	31.3	0.7923
AT2G20210			RNI-like superfamily protein (...		Lus10011909 [exp]	35.2	0.7941

Compare expression of checked genes

Lus10033300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.